PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.D6G4F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 258aa    MW: 29130.2 Da    PI: 6.6369
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.D6G4FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-183891356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 k+++++ eq+++Le+ Fe  +++  e++ +LA++lgL+ rq+ +WFqNrRa++k
  Araip.D6G4F 38 KKRRLNMEQVKALEKSFELGNKLEPERKMQLARSLGLQPRQIAIWFQNRRARWK 91
                 456899***********************************************9 PP

2HD-ZIP_I/II131.14.2e-4237127191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlE+dy++Lkr+++a+k++n++L++++++L++++
  Araip.D6G4F  37 EKKRRLNMEQVKALEKSFELGNKLEPERKMQLARSLGLQPRQIAIWFQNRRARWKTKQLERDYDQLKRQFEAVKSDNDALHAQNQKLQAQI 127
                  69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-191894IPR009057Homeodomain-like
SuperFamilySSF466891.34E-193195IPR009057Homeodomain-like
PROSITE profilePS5007117.1843393IPR001356Homeobox domain
SMARTSM003891.8E-183697IPR001356Homeobox domain
PfamPF000467.8E-163891IPR001356Homeobox domain
CDDcd000864.72E-153894No hitNo description
PRINTSPR000315.5E-66473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000315.5E-67389IPR000047Helix-turn-helix motif
PfamPF021832.1E-1593133IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSFSGIDLGG GGGGGGVEEG NNNGEEELSD DGSQIGEKKR RLNMEQVKAL EKSFELGNKL  60
EPERKMQLAR SLGLQPRQIA IWFQNRRARW KTKQLERDYD QLKRQFEAVK SDNDALHAQN  120
QKLQAQILAL KNREATTESI NLNKDTEGSC SNRSENSSEI KFDISTRTPT PTTTTTTTTI  180
VDSPLSSKPF FPSSSSSTRP PHQLFQISRP EIHLHQCHQQ NNNNNNHVVA KEESLSSMFV  240
AMDDQSGFWP WLEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18593RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.D6G4F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016202718.10.0homeobox-leucine zipper protein ATHB-13 isoform X2
SwissprotQ8LC038e-96ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A444Z5I10.0A0A444Z5I1_ARAHY; Uncharacterized protein
STRINGevm.model.supercontig_183.291e-111(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.16e-85HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]