PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.CC7W1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 461aa    MW: 50968.9 Da    PI: 6.5077
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.CC7W1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52151431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Araip.CC7W1  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS- 110
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Araip.CC7W1 111 NGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5910175IPR003441NAC domain
PROSITE profilePS5100557.35215175IPR003441NAC domain
PfamPF023651.8E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MPESMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNTTND ANIVSNVMGD AAQEEGWVVC RIFKKKNHLK  180
TLDSPLTSSI SGDGGRRSHH HHHLFDSCDE GALEQILQQM GRGGGGGCKE EINNYDQSNN  240
NNNNNNNNYG GSSSLTTRYA RPFDTINNNV DSRFLKLPSL ESPKSTSMDH NNNNNNDNDD  300
SNENNGYHPI IPVEMVTENE GSFTCDNPNN MFHHHHLGGG GGGGSDGGGG LTNWVALDRL  360
VASQLNGQTE ASRQLSCFND PTMGYGTGNH DLLFPTVRST SSLTSSSASI NPRAVISAGA  420
GAYISPGAQD YTTTSEIDLW NFARSTSSLL SSSEPLCHVS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4891789171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.CC7W1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020970938.10.0NAC domain-containing protein 43
RefseqXP_025631806.10.0NAC domain-containing protein 43
SwissprotQ84WP61e-132NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A445ACL20.0A0A445ACL2_ARAHY; Uncharacterized protein
STRINGGLYMA16G02200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-118NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]