PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.BSZ17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GATA
Protein Properties Length: 326aa    MW: 35648.7 Da    PI: 5.146
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.BSZ17genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18243276134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  Araip.BSZ17 243 CSHCQVQKTPQWRTGPMGPKTLCNACGVRYKSGR 276
                  *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.7E-8128319IPR016679Transcription factor, GATA, plant
SMARTSM004011.6E-14237291IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14240300No hitNo description
Gene3DG3DSA:3.30.50.102.5E-14241274IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.398241273IPR000679Zinc finger, GATA-type
CDDcd002021.74E-14242299No hitNo description
PfamPF003202.8E-16243276IPR000679Zinc finger, GATA-type
PROSITE patternPS003440243268IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEVVVAKALK PSLRGELIFQ PPLALGDEFL CFNAVNNGGA VGEDFSVDDL LDFSEFQHGS  60
VGKGIDVSEE EEDEEDEEKD STSGSSSQDR TENDTNSNSS NAAVDSDSIF AGELSVPDDD  120
LADLEWVSHF VDDSIPELSL LYPVRSEQTR ARAQPEPKPG SAVTSLPHGV PVKPRTTRTR  180
KPNGRLLWSF GNLFSPPSSP SSCSSSVLSS TAAPLVLHGE PPAKKQKRKP EEQACGLQFQ  240
RRCSHCQVQK TPQWRTGPMG PKTLCNACGV RYKSGRLFPE YRPACSPTFS GDIHSNSHRK  300
VLEMRRRKEM SGPEPSPDRA FMLPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186938.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A151RII01e-129A0A151RII0_CAJCA; GATA transcription factor 12
STRINGGLYMA12G04180.21e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-51GATA transcription factor 5