PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.B8BRU
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 669aa    MW: 73352.3 Da    PI: 6.3153
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.B8BRUgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.91.2e-24192241151
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQ
  Araip.B8BRU 192 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQ 241
                  79*******************.***************************** PP

2Response_reg83.18.9e-28201261109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEE CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdf 97 
                   vl vdD+p+ +++l+++l++ +y +v++++++ +al+ll+e+++Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + ++ Ga d+
   Araip.B8BRU  20 VLAVDDDPTCLMVLETLLRRCQY-HVTTTSQAIKALKLLRENKFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKGISHGACDY 114
                   799********************.**************************************87754.558************************** PP

                   EESS--HHHHHH CS
  Response_reg  98 lsKpfdpeelvk 109
                   l Kp+ +eel +
   Araip.B8BRU 115 LLKPVRIEELKN 126
                   *********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.8E-1541667IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.1E-4416152No hitNo description
SuperFamilySSF521722.85E-3816138IPR011006CheY-like superfamily
SMARTSM004484.8E-3218128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.6419132IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.8E-2520126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.47E-2921132No hitNo description
PROSITE profilePS512949.011189248IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-25189242IPR009057Homeodomain-like
SuperFamilySSF466891.61E-15190242IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-22192242IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MTMENGVDDS SDQFPKGMRV LAVDDDPTCL MVLETLLRRC QYHVTTTSQA IKALKLLREN  60
KFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSANGDT KLVMKGISHG ACDYLLKPVR  120
IEELKNIWQH VIRRKKFDSK EKNKTRNSDK PSSEXXXXQN GKLNKKRKDQ DDEEDEEQDN  180
GHDNEDPSAQ KKPRVVWSVE LHRKFVAAVN QLGIDKAVPK KILDLMNVEK LTRENVASHL  240
QAISVALYCY FFANQQANMV AALGSADPSY LRMGSLSGVG HLQALSGSGQ FPNNAFRSFP  300
PNGMVTRLNT PAGLNVHGFP SSGAFHLGQS QNLNSSTVEQ LKYRSSIVPV NQNGVHGMQV  360
PMGLDPLQHN KGVIPVQNLT TGIDAKTNFP VSNKLPDPQS RVASGAHPPL LGSSSNALML  420
EARPQDTQGV LEYENLSSSV PSQHSELPFS LLDQGRYSDN WSSAVQSSGI QTGSYPSSES  480
FRQTAIPATD NMASLPLQEG NLSVSSSISL LPNQSYNSLI DTHSQAVILA NRTGHVSNSD  540
APFQGWDDRN EDASYHSNAV CNTINTVAPG SSSVGHTTIN STLHRNLEFN YGDSLQMKHD  600
AMTKLAKETS LKPHQGNIMN PQKSQQGNFS NNVGSLEDLV SSMMKQEQDE MKILDGGFIC  660
DNYSGGISM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23188247160ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.B8BRU
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0196017e-49CU019601.8 M.truncatula DNA sequence from clone MTH2-12A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025681106.10.0two-component response regulator ARR12 isoform X1
TrEMBLA0A444X5V50.0A0A444X5V5_ARAHY; Uncharacterized protein
STRINGGLYMA06G06730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-123response regulator 12