PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.AWF0A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 354aa    MW: 39740.4 Da    PI: 7.8977
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.AWF0AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.2e-51191521128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkk......leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                  lppGfrFhPtd+el+++yL+ kv +++      +++++v + evd++++ePw+Lp+ +k +e+ewy +s rd+ky+tg r+nrat++gyWkatgkdk+
  Araip.AWF0A  19 LPPGFRFHPTDQELITFYLASKVFNNTnattatTTTTHVnFVEVDLNRCEPWELPEVAKMGEREWYLYSVRDRKYPTGLRTNRATAAGYWKATGKDKQ 116
                  79*********************9999776665233334599*************8888999************************************ PP

          NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  v+  +g lvg+kktLvfykgrap+g+kt+Wvmhe+rl
  Araip.AWF0A 117 VYG-GGGLVGMKKTLVFYKGRAPRGQKTKWVMHEFRL 152
                  ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5514160IPR003441NAC domain
PROSITE profilePS5100550.11419178IPR003441NAC domain
PfamPF023651.7E-2520152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEELACELSD HEKRNAQGLP PGFRFHPTDQ ELITFYLASK VFNNTNATTA TTTTTHVNFV  60
EVDLNRCEPW ELPEVAKMGE REWYLYSVRD RKYPTGLRTN RATAAGYWKA TGKDKQVYGG  120
GGLVGMKKTL VFYKGRAPRG QKTKWVMHEF RLDPHSSPSL SKHQQQHDPL LLFQTPSSLF  180
NDHISHSHNH NQNLLSPLLH PFPIPEETTK TRSSTINSNH YPPPPPSSQH SLKLNKSTKL  240
TKTVPPSPSF FQYQQLLEDY PNLLHWIDSG NNNNNNCNAN NTASSVEIMD AAAAGLIAFS  300
SGGPSPTPNN NNNNNNNNAE IMMMSSSSAS MLHILDDAPL GIQSWPHHHH HHLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-43111524140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.AWF0A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016164895.20.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_025667467.10.0protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A445CD350.0A0A445CD35_ARAHY; Uncharacterized protein
STRINGAES741212e-91(Medicago truncatula)
STRINGXP_007135979.12e-91(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.13e-75NAC family protein