PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ATU0E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 329aa    MW: 38343.5 Da    PI: 5.6862
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ATU0EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.77.1e-142061243
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  i+n++ r+++f +R+ gi+KK +  S LC +e+++i+++ +
  Araip.ATU0E 20 CIKNERERKISFMQRKDGIMKKISTFSKLCKVEACLIVYGDD 61
                 69**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.111160IPR002100Transcription factor, MADS-box
SMARTSM004328.2E-91170IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-161185IPR002100Transcription factor, MADS-box
PfamPF003195.2E-122168IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDIFLNQRFS MGRGKTVYEC IKNERERKIS FMQRKDGIMK KISTFSKLCK VEACLIVYGD  60
DSSRPMTWPQ EHSKVQSIIK KYEVQKNNET HPIIFDEEEF FKNKKIMIEA EISKLRKKVF  120
KLKYPTMDPI FTTLDGNQLM EFIALVNTKI KACKKRIDML KESNQDNGSN FNVDQNQSQL  180
NFMNNISNHD YALHHDNLVY QTQNPKFDPN VTYFVAKNNG MIMDSISQVN VSLDCSTTNQ  240
VAIMNSKEKN VIVDSTNQIS EDGDLINWDD FVEVENWIDQ LQYETDLKEI LSHQSQNVPQ  300
SSQILPPITM DGFLADEKNN DHQFQPFNM
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.ATU0E
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186302.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A445E7K00.0A0A445E7K0_ARAHY; Uncharacterized protein
STRINGGLYMA08G22700.12e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.14e-15AGAMOUS-like 46