PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.AC5JZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 222aa    MW: 25412.1 Da    PI: 9.2193
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.AC5JZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.61.7e-2851132186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrergf+rsp+qCk+kw+nl +ryk  ++++ ++    s++cp+f++l+
  Araip.AC5JZ  51 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGFRRSPEQCKCKWKNLVNRYKGKETSDPEH----SRQCPFFEELH 132
                  7****************************************************************999986....899******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-448110IPR001005SANT/Myb domain
PfamPF138377.9E-2450133No hitNo description
CDDcd122031.85E-2850115No hitNo description
PROSITE profilePS500907.65452108IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MFGGEDARAA RLAMVAPPQP QMLNPATSSV ISGEISPTTA GREERVPAQP QWSQQETREF  60
IAIRAELERD FTASKRNKTL WEVVSSKMRE RGFRRSPEQC KCKWKNLVNR YKGKETSDPE  120
HSRQCPFFEE LHAVFTERAR NMQRLHLESE ARSAQTKKGV KRSSGERSSE EYSEDDEEVE  180
DDSEEEKPSR SNARKRKVDK TDKSSKANNP SNTFSNTARN AQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1552118773DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201265.11e-161PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0L9URU21e-123A0A0L9URU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3G01e-123A0A0S3T3G0_PHAAN; Uncharacterized protein
STRINGGLYMA01G35370.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-34Trihelix family protein