PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.A6QWC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 481aa    MW: 54595.8 Da    PI: 5.7725
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.A6QWCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.3e-48161442128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                  p+GfrF+Ptdeelv++yL++k+ ++++++ ++i+++d++kvePw++p  +kvk+++ ew+fFs rd ky ++kr+nratk gyWkatg+d+ ++++ +
  Araip.A6QWC  16 PVGFRFKPTDEELVSYYLNHKLLNDNFPI-DIIPDIDLCKVEPWQIPalSKVKSDDPEWFFFSGRDYKYGKSKRSNRATKGGYWKATGQDRFIKERgT 112
                  89***************************.99***************5448999999**************************************966 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   +++g kktLvfy+gr p+g+kt+Wv+hey++
  Araip.A6QWC 113 MNVIGSKKTLVFYSGRVPNGVKTNWVIHEYHA 144
                  677***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-5214162IPR003441NAC domain
PROSITE profilePS5100553.17515162IPR003441NAC domain
PfamPF023651.7E-2516143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MARSATIPFP ILDFIPVGFR FKPTDEELVS YYLNHKLLND NFPIDIIPDI DLCKVEPWQI  60
PALSKVKSDD PEWFFFSGRD YKYGKSKRSN RATKGGYWKA TGQDRFIKER GTMNVIGSKK  120
TLVFYSGRVP NGVKTNWVIH EYHATTFDDS QRNFVLCRLM KKVERKSEDG TDAQACDEGE  180
PSTHMEEADE SVSTMFDSPD VDMDSIFHTL PQDRSSSQHS PVGIEQQESF PFSPSENYYL  240
VNEDSSMHIQ FETNEEKQDA EKFADSILDS GNIAMFEERQ QHHTFMNNHL RSVPSMRVCY  300
ESSDTDAEVV SRRADSREYH VSKMVQSSHS AARTDKTRSI SSEDFWGVDS SSCDSNADKP  360
FEINSIEISS PPPALSGSKN QYNPRLSQTH RKVSSNAIPN LEDKKKLTTV EQSRRDQEKA  420
RKTSPGKKLE TRSSDVNRIG SFIHLEPCSS SESLTPRAVY LVNVVIGILL LLAISWDVLS  480
C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-371516217165NO APICAL MERISTEM PROTEIN
1ut4_B2e-371516217165NO APICAL MERISTEM PROTEIN
1ut7_A2e-371516217165NO APICAL MERISTEM PROTEIN
1ut7_B2e-371516217165NO APICAL MERISTEM PROTEIN
3swm_A2e-371516220168NAC domain-containing protein 19
3swm_B2e-371516220168NAC domain-containing protein 19
3swm_C2e-371516220168NAC domain-containing protein 19
3swm_D2e-371516220168NAC domain-containing protein 19
3swp_A2e-371516220168NAC domain-containing protein 19
3swp_B2e-371516220168NAC domain-containing protein 19
3swp_C2e-371516220168NAC domain-containing protein 19
3swp_D2e-371516220168NAC domain-containing protein 19
4dul_A2e-371516217165NAC domain-containing protein 19
4dul_B2e-371516217165NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.A6QWC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182631.10.0NAC domain-containing protein 62-like isoform X1
RefseqXP_025631880.10.0NAC domain-containing protein 62 isoform X1
TrEMBLA0A445ACS60.0A0A445ACS6_ARAHY; Uncharacterized protein
STRINGGLYMA07G05351.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.12e-49NAC transcription factor-like 9