PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.9W6SR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 633aa    MW: 71567.8 Da    PI: 6.54
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.9W6SRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.59e-5661331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yLk+k++g+k++l e+i+evd+yk+ePwdLp +  + +++ ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v s +
  Araip.9W6SR   6 LPPGFRFHPTDEELVAYYLKRKINGRKIDL-EIIPEVDLYKCEPWDLPgRsLLPGKDLEWYFFSPRDRKYPNGSRTNRATKCGYWKATGKDRKVNS-Q 101
                  79****************************.99***************5334455777**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv+y+grap+g++t Wvmheyrl
  Araip.9W6SR 102 SRAVGMKKTLVYYRGRAPHGSRTGWVMHEYRL 133
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-634158IPR003441NAC domain
PROSITE profilePS5100561.2236158IPR003441NAC domain
PfamPF023651.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIDLEIIPE VDLYKCEPWD LPGRSLLPGK  60
DLEWYFFSPR DRKYPNGSRT NRATKCGYWK ATGKDRKVNS QSRAVGMKKT LVYYRGRAPH  120
GSRTGWVMHE YRLHERECET NAASGLQDAY ALCRVFKKAA VIIPKVADHY AADNIMMMTT  180
DSQGTPQVFD TMPWDHHIGH NGKCPHLSQD PFLNNLPSSS SSSFPHYGAL TYSPSKVDVA  240
LECARMQHSF SMPPLEVVEE FPNVGISELN IMTRGTTSMC GGSMNNNNES DILQQILSLA  300
NANVSSHEFT NHSNHSHTLL GGNNANYAAP HHHEHDFAFN AGTSYTNHAV NDMNPMRYEI  360
QDQNLRTIEI GDLESEFKSF MEEQKTVPIE DISSFQTNIQ ENEVQAESEL HNSNKEFSEA  420
DIDNFSMGFI NDGDPNENFI DDDDNIDYSN STSFEVLEET KVSHGMFVAT RRVADTFFHQ  480
IVPSQTIKVQ LNPVTIMGNN SSMEMLKNNQ ESLFKKLMMM KSPNTLASAI VFIFALLLTL  540
CVNLKGQVEN YWASRSDDDT INVKKKCCYD ANSSMKRMKQ VAHKIIWNQQ EKSWCVGIKS  600
GRGFSVVLKK IGIFLSISLA LCTMWVNHVT ISP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-57116015170NAC domain-containing protein 19
3swm_B2e-57116015170NAC domain-containing protein 19
3swm_C2e-57116015170NAC domain-containing protein 19
3swm_D2e-57116015170NAC domain-containing protein 19
3swp_A2e-57116015170NAC domain-containing protein 19
3swp_B2e-57116015170NAC domain-containing protein 19
3swp_C2e-57116015170NAC domain-containing protein 19
3swp_D2e-57116015170NAC domain-containing protein 19
3ulx_A2e-57215811168Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.9W6SR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1518226e-46AC151822.29 Medicago truncatula clone mth2-32h21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193619.10.0NAC domain-containing protein 86-like isoform X1
RefseqXP_025638634.10.0NAC domain-containing protein 86 isoform X1
TrEMBLA0A444ZVT10.0A0A444ZVT1_ARAHY; Uncharacterized protein
STRINGXP_004503093.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-132NAC domain containing protein 28