PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.989UZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SRS
Protein Properties Length: 283aa    MW: 30862.2 Da    PI: 8.1355
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.989UZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702172.12.8e-53872346154
       DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae...skkel 100
                    C dCGn+akkdC+++RCR CCk rg+dC+thv+stWvpa krrer+ + +    +aa++++    k+++   s ++++ s+t+++s +   ++   
  Araip.989UZ  87 RVCTDCGNRAKKDCVYRRCRSCCKGRGYDCTTHVRSTWVPALKRRERHVAVTGVGGEAANKRT----KNNNGCASGSATSHSHTSTNSDScysHQDAR 180
                  47*********************************************7777666544444333....3333333333333333333332200022333 PP

       DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   ++slP +v+++avfrc rvs+v +ge+e+aY ++v+i+Ghvf+G+Lyd+G++ 
  Araip.989UZ 181 FKESLPGHVRAPAVFRCHRVSTVGNGENEFAYLATVHISGHVFRGFLYDHGVDP 234
                  4456***********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR016234.7E-2488130IPR006510Zinc finger, lateral root primordium type 1
PfamPF051423.6E-5288233IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.2E-22185232IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSMLGLTDLV FIAPNPSSLH HHRQQQLIST ENDNNNNPLS VGFGIFPLLA ATPCVQVVQN  60
QSNEEAMEDS GKKKKKIDED ENGGEFRVCT DCGNRAKKDC VYRRCRSCCK GRGYDCTTHV  120
RSTWVPALKR RERHVAVTGV GGEAANKRTK NNNGCASGSA TSHSHTSTNS DSCYSHQDAR  180
FKESLPGHVR APAVFRCHRV STVGNGENEF AYLATVHISG HVFRGFLYDH GVDPKNTIMP  240
SYASELQLGN NCISNGKNKE CSSSAIGVTT NEYDNLYSAS AAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182232.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
TrEMBLK7KK009e-99K7KK00_SOYBN; Uncharacterized protein
STRINGGLYMA04G17885.13e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57043154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-45Lateral root primordium (LRP) protein-related