PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.8BB4D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WOX
Protein Properties Length: 379aa    MW: 41560.5 Da    PI: 8.7961
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.8BB4DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-1743102256
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                  ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k
  Araip.8BB4D  43 KPRWNPKPEQIRILESIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRTK 102
                  89*****************99*************************************99 PP

2Wus_type_Homeobox111.64.3e-3642104264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R ++k
        Araip.8BB4D  42 PKPRWNPKPEQIRILESIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRTKHK 104
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-918102IPR009057Homeodomain-like
SuperFamilySSF466893.59E-1239107IPR009057Homeodomain-like
PROSITE profilePS5007110.54439104IPR001356Homeobox domain
SMARTSM003896.7E-841108IPR001356Homeobox domain
CDDcd000865.98E-842104No hitNo description
PfamPF000463.3E-1543103IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MFKSKPTWQH DITITATSSS SSSTSSSSRT SPYSCDDRSP EPKPRWNPKP EQIRILESIF  60
NSGMVNPPRD EIRKIRAQLQ EYGQVGDANV FYWFQNRKSR TKHKLRHLHT KNNPPPPPPP  120
SSTSSSSSDK SSSPPTTTTT TTSAATTNTY FYTHNHTATI PPPPPPPHVA AETFIFPLQH  180
HQGNSTTTTI TSSPQGLFFS ELSNVVQAHH HQPSPPPPHQ LMMHNVVGPC TSLLLSEIMM  240
NNASKKDHHQ EHASSNKSLK LMHHGGGHHH TPKLSFCVTP PTTTTATLVP PTTTPSLLTQ  300
DAVGTGDGSE KITVFINDVA FEVAAGPFNV REAFGEDAVL IHAITGQPLL TNQWGLTLHS  360
LHHGASYYLL LHTLPHAPY
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.8BB4D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177677.10.0WUSCHEL-related homeobox 9-like
RefseqXP_025682781.10.0WUSCHEL-related homeobox 9 isoform X1
RefseqXP_025682782.10.0WUSCHEL-related homeobox 9 isoform X2
TrEMBLA0A445BBQ10.0A0A445BBQ1_ARAHY; Uncharacterized protein
STRINGXP_007148089.11e-110(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-47homeobox-3