PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.87M6M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 277aa    MW: 31363.8 Da    PI: 6.3144
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.87M6MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-1749101456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + +++ eq+++Le+ Fe  +++  e++ +LAk l+L+ rq+ +WFqNrRa++k
  Araip.87M6M  49 KKRLNIEQVKALEKSFELGNKLEPERKVQLAKALNLQPRQIAIWFQNRRARWK 101
                  4568889*********************************************9 PP

2HD-ZIP_I/II124.83.9e-4047139193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rl+ eqvk+LE+sFe  +kLeperKv+la++L+lqprq+a+WFqnrRAR+ktkqlE++ye+Lk++++alk +n++L+ ++++L++el++
  Araip.87M6M  47 EKKKRLNIEQVKALEKSFELGNKLEPERKVQLAKALNLQPRQIAIWFQNRRARWKTKQLEREYESLKKQFEALKVDNDALKVQNQKLHAELQA 139
                  69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.38E-1935105IPR009057Homeodomain-like
PROSITE profilePS5007116.42243103IPR001356Homeobox domain
SMARTSM003897.3E-1746107IPR001356Homeobox domain
CDDcd000863.70E-1548104No hitNo description
PfamPF000466.5E-1549101IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-1855102IPR009057Homeodomain-like
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PfamPF021838.3E-14103140IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGSHQFLGGG GPFMLKRSMS FSGIENKCGG DGDDDLSDDG FGFQFGEKKK RLNIEQVKAL  60
EKSFELGNKL EPERKVQLAK ALNLQPRQIA IWFQNRRARW KTKQLEREYE SLKKQFEALK  120
VDNDALKVQN QKLHAELQAL IKGKEYYCEE EDGAIISNLN KKEAGEGSWS NNNNNNGCSD  180
NNNISSSDIN LDLSTTPIIN TSPVSSQNAK TTLESNNDNS LKPNNIIQLL QYSPPSSSRP  240
QGIPHQDEGL CNMFHHQIDD QQNLWPWPEH QPHNNFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.87M6M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196791.10.0homeobox-leucine zipper protein HAT7-like isoform X1
RefseqXP_025649912.10.0homeobox-leucine zipper protein HAT7 isoform X1
SwissprotQ004664e-67HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A444ZQ180.0A0A444ZQ18_ARAHY; Uncharacterized protein
STRINGGLYMA09G37410.19e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.17e-57homeobox 3