PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.7P7D7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 274aa    MW: 30196.5 Da    PI: 8.0056
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.7P7D7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.64.2e-3871061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C++apyfpa++p++f++vh++FGasnv k+l++lp+++re+a++sl++eAear+ dPvyG++  +  lq++l+q +a la +k
  Araip.7P7D7   7 PCAACKFLRRKCTPECIFAPYFPANNPQRFECVHRVFGASNVGKILNELPPSQREEAVESLAFEAEARQCDPVYGCTLQVCILQKKLRQRRALLANAK 104
                  7******************************************************************************************9999888 PP

       DUF260  99 ee 100
                  +e
  Araip.7P7D7 105 RE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3036107IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-377103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSTTTPCAA CKFLRRKCTP ECIFAPYFPA NNPQRFECVH RVFGASNVGK ILNELPPSQR  60
EEAVESLAFE AEARQCDPVY GCTLQVCILQ KKLRQRRALL ANAKRELSAY INPQAIQGPF  120
NPQEKPLSSP ADHLGPPCSP NVVQYSPILG PSYGLDVVQS SAHLGLSDCP DDAPFFMPAI  180
QHNGSLGGGG AADPKLDPGQ QELLEAQQLA AAAAIREQQQ AIMMRNYVQQ QQQEYLRHNA  240
AAGIEPVAAA AALRRCQWMW SVWPHGCIFR WSRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016170744.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_016170745.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_016170746.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2905722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-40ASYMMETRIC LEAVES 2-like 1