PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.79TDF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 678aa    MW: 77254.9 Da    PI: 5.6427
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.79TDFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.2e-5661331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd++v s +
  Araip.79TDF   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIAEVDLYKCEPWDLPgKsLLPGKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNS-Q 101
                  79****************************.99***************6434445667**************************************.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++vg+kktLv+y+grap+g++tdWvmheyrl
  Araip.79TDF 102 CRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                  889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-644157IPR003441NAC domain
PROSITE profilePS5100561.7816157IPR003441NAC domain
PfamPF023653.1E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEIIAE VDLYKCEPWD LPGKSLLPGK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVNS QCRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDDRECEN ASSGLQDAYA LCRVFKKSAV ITPKVDEEHH HHHHYVNANN  180
HNNSSHALPI TSDQSSSMEL YSEGRGEDLD NSSNYLVPID TTCTLPLNNM VMNNNNSDAS  240
FNSRDNNGKW SQFVSEDPLF SFPTSSSSFA NSYGSITYPP SKVDIALECA RMQHRFTMPP  300
LEVEDFPHVG TSELKMTELT SGAASAVHGT RNETDILQEI LSVAHASQEL INHSSYSSSW  360
GGDGGGNHEN CATHGDDFTF MVGSTNYNNN NLNDINSMRY VDRNWEDPNS SRSIDIGYLD  420
EEFKGERMVE NLRWVGMSTK DLEKNFTEEQ KIVPIEDISS FRTNNKEENE VQESEQHHSN  480
KELLINDFSL GFNPNNNNSE NFLDDDHNNM DNDDYSSSPS FEVIEEIRVS HGSMFVSTRR  540
VADTFFHQIV PSQTVQVHLL NPVITSNEEE TLMMIMERNQ GYFGDFLFRT IATAFVFIFA  600
LVFVHCDYLK EEVELVKRKR SSQSSSKIMK WSNNNKVWFV GFKSSEKGFG AILKKIGIFL  660
TISLALCTMW ANHVIVNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-59115915170NAC domain-containing protein 19
3swm_B1e-59115915170NAC domain-containing protein 19
3swm_C1e-59115915170NAC domain-containing protein 19
3swm_D1e-59115915170NAC domain-containing protein 19
3swp_A1e-59115915170NAC domain-containing protein 19
3swp_B1e-59115915170NAC domain-containing protein 19
3swp_C1e-59115915170NAC domain-containing protein 19
3swp_D1e-59115915170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.79TDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166194.10.0NAC domain-containing protein 86-like
RefseqXP_025668728.10.0NAC domain-containing protein 86
TrEMBLA0A444YC830.0A0A444YC83_ARAHY; Uncharacterized protein
STRINGGLYMA14G39080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-143NAC domain containing protein 28