PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.714GL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 559aa    MW: 63262.1 Da    PI: 4.3113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.714GLgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1707.5e-53181442128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  +pGfrFhPtdeelv++yLk+k+ gkkl+l +vi e+d+yk++P++Lp  + +++++++w+fF++rd+ky++g r+nrat++gyWkatgkd++v++ ++
  Araip.714GL  18 MPGFRFHPTDEELVMYYLKRKICGKKLKL-DVILETDVYKWDPEELPgiSVLRTGDRQWFFFTHRDRKYPNGARSNRATRQGYWKATGKDRNVTC-NS 113
                  69***************************.99***************644778899***************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg+kktLvfy+grap+ge+tdWvmhey++
  Araip.714GL 114 RSVGVKKTLVFYRGRAPNGERTDWVMHEYTM 144
                  9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5815167IPR003441NAC domain
PROSITE profilePS5100554.16517167IPR003441NAC domain
PfamPF023651.2E-2719143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MGAEAGATEC FSKAMASMPG FRFHPTDEEL VMYYLKRKIC GKKLKLDVIL ETDVYKWDPE  60
ELPGISVLRT GDRQWFFFTH RDRKYPNGAR SNRATRQGYW KATGKDRNVT CNSRSVGVKK  120
TLVFYRGRAP NGERTDWVMH EYTMDEEELN RCQDIKDYFA LYKLYKKSGP GPKNGEQYGA  180
PFKEEEWADD ECVDFNINSA DREVVNTVPV NDQLPPLADD EVTDMINQIL DNELALDQQF  240
GDDLLEFPQV VAEETQSTVV DQFSEAVTDP EYNDIYHSTS QHYDAQNVNF NQSVASHLHA  300
PEGSEVISTA NIQVEDYNFQ EDDFLEINDL NGSELTIPNM ETPVENLQFE DGLCELDLFQ  360
DAEMFLRDLG PINEETIPHS YMNNAPGSNI ENQNYHLLPN PEDTTQNVHE FWMHDERNTL  420
SLFEGFDDSV SQQNPGAVCD SASFPTTEGY DNQSSIAEDV ATSRFSSALW SFVESIPTTP  480
ASAAENALVN RALNRMSSFS RVKINIKPTN TAAGKDTATT KRVGRKGFSF LFFPILIALC  540
AFLWVSLGTF RLLGRCIAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-481914417140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.714GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016175285.10.0NAC domain-containing protein 17
RefseqXP_025677674.10.0NAC domain-containing protein 17
TrEMBLA0A444XU690.0A0A444XU69_ARAHY; Uncharacterized protein
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.11e-135NAC domain containing protein 16