PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.712IZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family VOZ
Protein Properties Length: 477aa    MW: 53112.7 Da    PI: 5.8282
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.712IZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4464.4e-1372014171217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkd+llfaalsa++qgk+vgipecegaatakspwna+elfdl
  Araip.712IZ 201 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMSPVLRPGGIGLKDNLLFAALSARAQGKDVGIPECEGAATAKSPWNAPELFDL 298
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                  s+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei+++da+alyrlelklvd+kk++
  Araip.712IZ 299 SVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEISKCDACALYRLELKLVDGKKNS 396
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrlta 217
                  k+kv++ds+adlqk++grl+a
  Araip.712IZ 397 KAKVTNDSVADLQKQMGRLSA 417
                  *******************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MKKVSKTSCK SVSHRLFKDK AKNRVDDLQL MFLDLQFARK ESRTVDAAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDICRL LQLCEEEDDA SSPLAAPKPE PNDQTQQIGG  120
KVVFQEGQQQ HDFPLVDERK HSISGVQNVA ANNLEGPALE YHQFDLHQDF DHSFYTGFNG  180
IGYCEEDAIP QISSYLPSIC PPPSAFLGPK CALWDCPRPA QGLDWCQDYC SSFHAALALN  240
EGPPGMSPVL RPGGIGLKDN LLFAALSARA QGKDVGIPEC EGAATAKSPW NAPELFDLSV  300
LEGETIREWL FFDKPRRAFE SGNRKQRSLP DYSGRGWHES RKQVMNEFGG LKRSYYMDPQ  360
PLNHFEWHLY EYEISKCDAC ALYRLELKLV DGKKNSKAKV TNDSVADLQK QMGRLSAEFM  420
SDNKRPAKGR AKLNAKVGLG GVYSSSGRVA PLNGTYDYGL AAPYDYLVDN MGDYYGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.712IZ
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-176AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016190030.10.0transcription factor VOZ1 isoform X2
RefseqXP_025638335.10.0transcription factor VOZ1 isoform X2
RefseqXP_025638336.10.0transcription factor VOZ1 isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A444ZWC30.0A0A444ZWC3_ARAHY; Uncharacterized protein
STRINGGLYMA07G32374.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]