PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.6Y0GY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 280aa    MW: 32734.4 Da    PI: 5.6726
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.6Y0GYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.32.6e-183682249
          NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                  pGfrFhPtdeelv +yL++kve+k+l++ e ik+vdiyk++PwdLp+
  Araip.6Y0GY 36 LPGFRFHPTDEELVGFYLRRKVEKKPLKI-ELIKHVDIYKYDPWDLPS 82
                 69***************************.89**************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-2332131IPR003441NAC domain
PROSITE profilePS5100515.61735177IPR003441NAC domain
PfamPF023651.6E-73771IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDVAKLYMNN DYSEEHEHEH EDEDHEMMKE EKEVVLPGFR FHPTDEELVG FYLRRKVEKK  60
PLKIELIKHV DIYKYDPWDL PSTKTDWMMH EFRLPPNNNN GAKLLSNNQE ANNATKDLHE  120
AEVWTLCRIF KRIPTYKKYT PNLKDSSTSP LMNKPINNIN HQTDSSVTSI SCSLESDNNN  180
SKPFLTFTNT MTMGIQQCER KPLVIGHVDE RNNNFFLDHS SIHHQQAPTT ITTTALSSSS  240
YSSWNQHHLV EDYLFANENW DDLRSVVEFA TDPNNSKVYL
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.6Y0GY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150383e-49AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025668801.11e-131transcription factor JUNGBRUNNEN 1 isoform X1
TrEMBLA0A444YEP81e-129A0A444YEP8_ARAHY; Uncharacterized protein
STRINGGLYMA02G45371.14e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-22NAC domain containing protein 42