PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.6M6N8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Nin-like
Protein Properties Length: 137aa    MW: 16104.3 Da    PI: 8.7276
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.6M6N8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.51.5e-193484252
       RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                 +k ++ + +s++F++pi++A+++L+v+l  LKr+ R +GI+RWPhRk+ sl
  Araip.6M6N8 34 KKGLKRKSISECFYMPIAEASRHLKVGLIHLKRRWRDLGIQRWPHRKLMSL 84
                 578999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.37919104IPR003035RWP-RK domain
PfamPF020422.2E-153784IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MDVVERCDEE SDNAENEYVD NAWKEMSKDK GKGKKGLKRK SISECFYMPI AEASRHLKVG  60
LIHLKRRWRD LGIQRWPHRK LMSLQTLINN LQQQQQQQKG VDEDESSRIR SAIHILEREK  120
SLLEEIPHLQ LETTPKG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12935KGKGKKG
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.6M6N8
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020985692.15e-62protein RKD1-like
RefseqXP_025616427.15e-62protein RKD1-like
TrEMBLA0A445AB144e-96A0A445AB14_ARAHY; Uncharacterized protein
STRINGXP_004514420.11e-30(Cicer arietinum)
STRINGXP_007138178.11e-31(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.16e-24RWP-RK domain-containing protein