PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.609WS
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 363aa    MW: 41082.7 Da    PI: 7.7539
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.609WSgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.5e-5551311129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv+++ ++  ++i+ vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++ +g 
  Araip.609WS   5 LPPGFRFHPTDEELITYYLTRKVSENGFTS-KAIAVVDLNKSEPWDLPGKASMGEKEWYFFSLRDRKYPTGLRTNRATESGYWKTTGKDKEIFR-GGV 100
                  79*************************999.88***************988999****************************************.*** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrap+gek++Wvmheyrle
  Araip.609WS 101 LVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-643150IPR003441NAC domain
PROSITE profilePS5100560.7015150IPR003441NAC domain
PfamPF023651.7E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLTRKVSEN GFTSKAIAVV DLNKSEPWDL PGKASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TESGYWKTTG KDKEIFRGGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKNPFRTKD EWVVCRVFQK STAAKKPPQQ TSSSQPESPC DDTTSLVNEF  180
GDVIEFPNLN TNINNTNNNN NNSSSSSSSA LFPNNILISG QHIHHHHDLT NNNNNNNVNT  240
NMNLAMNWPP SSDHNVPWPS VGLLNPSISS MNSLILKALQ LRNNYQQREV ASTFAPSSYI  300
MPHHQGVVVP HQQVIIGTNN DDLITTSSNL INASSSSSSK VLECMPHQQQ QQQEQPFNLD  360
SLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-58415616171NO APICAL MERISTEM PROTEIN
1ut4_B3e-58415616171NO APICAL MERISTEM PROTEIN
1ut7_A3e-58415616171NO APICAL MERISTEM PROTEIN
1ut7_B3e-58415616171NO APICAL MERISTEM PROTEIN
3swm_A4e-58415619174NAC domain-containing protein 19
3swm_B4e-58415619174NAC domain-containing protein 19
3swm_C4e-58415619174NAC domain-containing protein 19
3swm_D4e-58415619174NAC domain-containing protein 19
3swp_A4e-58415619174NAC domain-containing protein 19
3swp_B4e-58415619174NAC domain-containing protein 19
3swp_C4e-58415619174NAC domain-containing protein 19
3swp_D4e-58415619174NAC domain-containing protein 19
4dul_A3e-58415616171NAC domain-containing protein 19
4dul_B3e-58415616171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.609WS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016203627.10.0protein CUP-SHAPED COTYLEDON 1 isoform X1
RefseqXP_025655954.10.0protein CUP-SHAPED COTYLEDON 1 isoform X1
TrEMBLA0A444Z0D40.0A0A444Z0D4_ARAHY; Uncharacterized protein
STRINGAES766981e-162(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-103NAC domain containing protein 58