PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.5AZ2K
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 1022aa    MW: 113048 Da    PI: 6.5004
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.5AZ2KgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.31.3e-3871061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C++apyfp ++p++fa+vh++FGasn+ k+l++l++ +reda++sl++eAear++ PvyG+v++i  lqq+l+q + +l ++k
  Araip.5AZ2K   7 PCAACKFLRRKCTQECIFAPYFPPDNPQRFACVHRVFGASNIGKILNDLSPCQREDAVTSLAFEAEARLDSPVYGCVRHIVILQQRLQQIQMDLLHAK 104
                  7*******************************************************************************************998888 PP

       DUF260  99 ee 100
                  +e
  Araip.5AZ2K 105 SE 106
                  76 PP

2DUF26096.52.7e-3071680511100
       DUF260  11 kCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   C+++C++apyfpa++p++f++vh++FGasnv k+l++lp+++reda++sl+++A+ar+r+PvyG++  ++ lqq l+q +a l+ +k+e
  Araip.5AZ2K 716 ICTPECIFAPYFPANNPERFECVHRVFGASNVGKILNELPPSQREDAVKSLAFQAKARLRNPVYGCTFQVSILQQLLRQRRAVLENAKRE 805
                  5*******************************************************************************9999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2376107IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-387103IPR004883Lateral organ boundaries, LOB
SuperFamilySSF525409.56E-5310372IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009311.8E-8318402IPR002182NB-ARC
PRINTSPR003645.1E-7325339No hitNo description
SuperFamilySSF520474.87E-15543710No hitNo description
Gene3DG3DSA:3.80.10.102.9E-13548707IPR032675Leucine-rich repeat domain, L domain-like
PRINTSPR003645.1E-7678694No hitNo description
PROSITE profilePS5089118.891705806IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-29717802IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1022 aa     Download sequence    Send to blast
MSSTNSPCAA CKFLRRKCTQ ECIFAPYFPP DNPQRFACVH RVFGASNIGK ILNDLSPCQR  60
EDAVTSLAFE AEARLDSPVY GCVRHIVILQ QRLQQIQMDL LHAKSELSAY INPQGIQGPF  120
SPHGIRGLPL YPQGKPPSSS AALFGPPYGP NVIQSLMPPS SVQHNGTMIA NADLDPEQRE  180
LLEAQQLAAQ QHDMMVRNYE HQHQQEYLRY NGATGIIEPV AAASPVSVVT ADGDGRGSGV  240
FAQMAAHSGA QGGELAPSLG LGTFDSGGTY HHQLQQQPPQ HGGVGENYVG LANRHHYPVE  300
AQFLLPSQQQ QPLESEDCKS IVRGCNGSPL ALKVIGGSLC HHPYEFWQTM KERLKSNKDL  360
DSHLQNCLDI VEDDKEKECF MDLGLFPEDQ RIRVPLLNDM WTELHELDED GVKAMNIIHS  420
LNSKNLANLI VTRKVATDVE MYYNNHFLMQ HDLLRELANH QSNQEPIEPR KRLAIDLTQN  480
GKNCPNWLVG QNQPGIISRM LSFLSVRGTQ QQQKQEQDTA PIMFVSTDET FTPDWYNMNP  540
DETEVLILNI HSNKYTFPDF IQKMRKLKVL IVTNQGFHPC ELNNFEVLGS LPCLKRISLE  600
KVSVPSLCKL RKCEICRIIC AFGSGIKISD ALPNLVELNI DYCMDMVELP SDFCNIMTMK  660
KLSITNCHKL SKLPPEIVML KNLEVLRLSS CSDLKEMPKS VGRLQQIWCL TSASCICTPE  720
CIFAPYFPAN NPERFECVHR VFGASNVGKI LNELPPSQRE DAVKSLAFQA KARLRNPVYG  780
CTFQVSILQQ LLRQRRAVLE NAKRELSAYI NPQAIQGPFN PQEKPLSSSP AHLGPSCCSN  840
IVQYSAHLNP FYDPNVVHSS VHLGLSDGPD DEPFFKPAIQ YNGSLGGGGA VPQADPGQQE  900
LLEAQQLAAA VAFREQQLRY NAAAGIEPVA AAAPYGGNVS GSGVFGHMGA PSGGQGGEMA  960
PCMGLGTFDS GESYHSQLQQ PPQHGVGGNY VLATQHHYPL EGHEKSVKLR EAAYWSWILN  1020
NQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2333723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-45ASYMMETRIC LEAVES 2-like 1