PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.54YKW
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WOX
Protein Properties Length: 195aa    MW: 22736 Da    PI: 6.8507
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.54YKWgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-21766357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq+  Le+l+++  r+psaee+++++++l    +++ ++V++WFqN++a++++
  Araip.54YKW  7 SRWNPTKEQISMLENLYKQgIRTPSAEEIQQITARLraygHIEGKNVFYWFQNHKARQRQ 66
                 7*****************99**************************************97 PP

2Wus_type_Homeobox117.56.1e-38668365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt+eQi +Le+lyk+G+rtP++eeiq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
        Araip.54YKW  6 SSRWNPTKEQISMLENLYKQGIRTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 68
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.37267IPR001356Homeobox domain
SMARTSM003893.9E-7471IPR001356Homeobox domain
SuperFamilySSF466891.83E-13473IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-9766IPR009057Homeodomain-like
PfamPF000462.6E-19766IPR001356Homeobox domain
CDDcd000869.47E-7868No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MEDGGSSRWN PTKEQISMLE NLYKQGIRTP SAEEIQQITA RLRAYGHIEG KNVFYWFQNH  60
KARQRQKQKQ HTLAYFNRSF LHHHHHQPAG MMRRIPDNNH SEEETMFDYD DDDKQQDRTL  120
DLFPLHPTGI LEGKKETQDN NNNNNMMTMM CSFMAPSSSS SSSLSTDDGH GYRHQQQQQL  180
PFFDFFVTSG HGQGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.54YKW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193169.11e-147WUSCHEL-related homeobox 5-like isoform X2
TrEMBLA0A445A9N61e-145A0A445A9N6_ARAHY; Uncharacterized protein
STRINGGLYMA12G06895.16e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-36WUSCHEL related homeobox 2