PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.4R4C1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 69aa    MW: 7757.93 Da    PI: 4.3287
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.4R4C1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM32.91.9e-102554130
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkklel 30
                 lp GfrF+Ptdeelv++yL++k++g+  e 
  Araip.4R4C1 25 LPLGFRFRPTDEELVDFYLRQKINGNGDEW 54
                 699*********************998554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-111854IPR003441NAC domain
PROSITE profilePS5100513.4212569IPR003441NAC domain
PfamPF023651.5E-72650IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MGAVEVFQQQ PLVVDAAPVL SLNSLPLGFR FRPTDEELVD FYLRQKINGN GDEWKGDFKV  60
FLVYAVGIV
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.4R4C1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025609826.13e-30protein NTM1-like 9 isoform X2
TrEMBLA0A444YAM69e-29A0A444YAM6_ARAHY; Uncharacterized protein
STRINGAES726642e-16(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.16e-14NAC domain containing protein 62