PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.4J5UA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 1226aa    MW: 134665 Da    PI: 6.344
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.4J5UAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.9e-2187142156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t++q++eLe++F+ +++p++++r++L+++lgL+ +qVk+WFqNrR+++k
  Araip.4J5UA  87 KKKYHRHTPHQTQELEAFFKDCNHPDEKQRADLSRRLGLENKQVKFWFQNRRTQMK 142
                  79999************************************************999 PP

2Homeobox65.66.9e-21535590156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t++q++eLe++F+ +++p++++r++L+++lgL+ +qVk+WFqNrR+++k
  Araip.4J5UA 535 KKKYHRHTPHQTQELEAFFKDCNHPDEKQRADLSRRLGLENKQVKFWFQNRRTQMK 590
                  79999************************************************999 PP

3START48.13.3e-162964212114
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                  la+ a++el+k+a+a++p+W k+    e++n++e+ +  +   +     + +ea+r++gvv+ ++  lve+++d   +W+e+++    +a tl+vi s
  Araip.4J5UA 296 LALVAMDELIKMAQADSPLWIKMDggkEILNQEEYARMSSFI-SptspgYVTEASRETGVVIINSSALVETMMDPE-RWSEMFPsmvsRAITLDVIAS 391
                  67889*********************9999999987655322.1356789****************9999988888.********************* PP

                  T......EEEEEEEEXXTTXX-SSX.EEEEEEEE CS
        START  88 g......galqlmvaelqalsplvp.RdfvfvRy 114
                  g      g      +  q+lsplvp R   f+R 
  Araip.4J5UA 392 GmggsrnG----SLQVNQLLSPLVPvRQLSFLRL 421
                  ***66433....444445666**********996 PP

4START142.73.5e-457449682206
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                  la+ a++el+k+a+a++p+W k+    e++n++e+ +  +   +     + +ea+r++gvv+ ++  lve+++d   +W+e+++    +a tl+vi s
  Araip.4J5UA 744 LALVAMDELIKMAQADSPLWIKMDggkEILNQEEYARMSSFI-SptspgYVTEASRETGVVIINSSALVETMMDPE-RWSEMFPsmvsRAITLDVIAS 839
                  67889*********************9999999987655322.1356789****************9999988888.********************* PP

                  T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE............EEEEE CS
        START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh............skvtw 166
                  g      g lq+m+ae q+lsplvp R   f+R+++q+ +g w++vd S+d  ++           +lpSg+l+++++ng              k+tw
  Araip.4J5UA 840 GmggsrnGSLQVMQAEIQLLSPLVPvRQLSFLRFCKQHAEGLWAVVDASIDAGRNFK---------RLPSGFLVQDTPNGFskasvalisnacHKITW 928
                  ******************************************************975.........7************************9669*** PP

                  EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                  veh  ++++l+h+l+r+l+ sgl +ga +w atlqrqce+
  Araip.4J5UA 929 VEHSQYDESLIHQLYRPLIASGLGFGAPRWIATLQRQCEC 968
                  **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-2173144IPR009057Homeodomain-like
SuperFamilySSF466891.35E-1974144IPR009057Homeodomain-like
PROSITE profilePS5007117.28184144IPR001356Homeobox domain
SMARTSM003897.7E-1986148IPR001356Homeobox domain
CDDcd000865.71E-1887144No hitNo description
PfamPF000462.0E-1887142IPR001356Homeobox domain
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PROSITE profilePS5084820.217286420IPR002913START domain
SuperFamilySSF559614.12E-9295475No hitNo description
PfamPF018523.8E-10296421IPR002913START domain
Gene3DG3DSA:1.10.10.603.4E-21521592IPR009057Homeodomain-like
SuperFamilySSF466891.35E-19522592IPR009057Homeodomain-like
PROSITE profilePS5007117.281532592IPR001356Homeobox domain
SMARTSM003897.7E-19534596IPR001356Homeobox domain
CDDcd000865.71E-18535592No hitNo description
PfamPF000462.0E-18535590IPR001356Homeobox domain
PROSITE patternPS000270567590IPR017970Homeobox, conserved site
PROSITE profilePS5084836.978734971IPR002913START domain
SuperFamilySSF559619.34E-27737968No hitNo description
CDDcd088758.25E-102738967No hitNo description
SMARTSM002349.3E-30743968IPR002913START domain
PfamPF018521.2E-37744968IPR002913START domain
SuperFamilySSF559611.19E-149871210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1226 aa     Download sequence    Send to blast
MPGFSAFELP LSSPLISMSK QNFPTLSFSN REMMEGHSEL GLIGDHFDGG LLGRIKEDGY  60
ESRSGSDNFE GASGDDQEAA NDQPKRKKKY HRHTPHQTQE LEAFFKDCNH PDEKQRADLS  120
RRLGLENKQV KFWFQNRRTQ MKTQIERHEN MILKQENERL RAENSVMREA MANPMCNNCG  180
GTAIPGQISF DEHQIRIENA RLKDELNRIC ALANKFLGRP ISSLASPMSL PASNSGLELG  240
IGRNGFSGGS SGLGMSMGLD FGDFSGGTLP AISGIRSPMG LMGNEIHAER SMLLELALVA  300
MDELIKMAQA DSPLWIKMDG GKEILNQEEY ARMSSFISPT SPGYVTEASR ETGVVIINSS  360
ALVETMMDPE RWSEMFPSMV SRAITLDVIA SGMGGSRNGS LQVNQLLSPL VPVRQLSFLR  420
LLVHHGHPLL LGSLITWVEH SQYDESLIHQ LYRPKTVGRG NIGGRVVADI SPKNHSCLRE  480
MMEGHSELGL IGDHFDGGLL GRIKEDGYES RSGSDNFEGA SGDDQEAAND QPKRKKKYHR  540
HTPHQTQELE AFFKDCNHPD EKQRADLSRR LGLENKQVKF WFQNRRTQMK TQIERHENMI  600
LKQENERLRA ENSVMREAMA NPMCNNCGGT AIPGQISFDE HQIRIENARL KDELNRICAL  660
ANKFLGRPIS SLASPMSLPA SNSGLELGIG RNGFSGGSSG LGMSMGLDFG DFSGGTLPAI  720
SGIRSPMGLM GNEIHAERSM LLELALVAMD ELIKMAQADS PLWIKMDGGK EILNQEEYAR  780
MSSFISPTSP GYVTEASRET GVVIINSSAL VETMMDPERW SEMFPSMVSR AITLDVIASG  840
MGGSRNGSLQ VMQAEIQLLS PLVPVRQLSF LRFCKQHAEG LWAVVDASID AGRNFKRLPS  900
GFLVQDTPNG FSKASVALIS NACHKITWVE HSQYDESLIH QLYRPLIASG LGFGAPRWIA  960
TLQRQCECLA IHMSSSIPSE DATAISPAGR RSMLKLAQRM ANNFFSGICL SSSQKWDTHH  1020
LGNVGDEIKV MTRKNIDVPG EPPSIVLCAA TSVWMPVSRQ RVFDFLRDER MRGEWVILSA  1080
IGQMKEMLRI SKGQVDGNSL SVLRANANNG GESSNNTLFL QETWNDTSCS ALLYSPVEVE  1140
SLKVVMSGGD STYVALIPSG FTIHPDGHSG TQDGDDGGSS GCLLTVGLQI LLNSLPTAKL  1200
TAESVETVND LITGTIQKIK ASLGVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.4J5UA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020979736.10.0homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A444YXS60.0A0A444YXS6_ARAHY; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]