PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.49QGA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 178aa    MW: 20116.4 Da    PI: 4.3092
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.49QGAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26046.31.2e-143584499
       DUF260 44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                  l+k l ++er++am++++ye+e+ra dPv+G++ vi++lq+++e  +ael+l+ +
  Araip.49QGA  3 DLIKPLGPTERNIAMETIIYESEMRAYDPVNGCCTVIQQLQSEIEYRQAELQLVLH 58
                 67888999*******************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.053160IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-11356IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MTDLIKPLGP TERNIAMETI IYESEMRAYD PVNGCCTVIQ QLQSEIEYRQ AELQLVLHRL  60
ALFKAQAQQQ SSSCNQANNV EGIPFQPDQY YEATNMDSNS SITHEVDLNA WMMQNLQSPA  120
LLSPLALTNE NENGNVGVDD NNGYVYDQKH MLDLGFKETK SNHQTPVEGM HYSGMKQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016167842.11e-131PREDICTED: LOB domain-containing protein 22-like, partial
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-16LOB domain-containing protein 22