PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.489C1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRF
Protein Properties Length: 415aa    MW: 44970.9 Da    PI: 7.6823
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.489C1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.42.1e-225798142
          WRC  1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42
                 daep rCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk+
  Araip.489C1 57 DAEPNRCRRTDGKKWRCSREVAPNHKYCERHMHRGRPRSRKP 98
                 79**************************************96 PP

2QLQ52.81.2e-18940233
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                 +FT aQ+ +L++Q+++yKy++a+ PvPpeLl+
  Araip.489C1  9 PFTSAQWRELERQAMIYKYMMASIPVPPELLL 40
                 8*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.7E-10845IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-13940IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.918944IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.41257101IPR014977WRC domain
PfamPF088795.8E-195898IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MAASLGRFPF TSAQWRELER QAMIYKYMMA SIPVPPELLL MPIAAASRSS PCINNNDAEP  60
NRCRRTDGKK WRCSREVAPN HKYCERHMHR GRPRSRKPRA RHDSHPYAAS SAAVTVAFSN  120
HSTRKDPSSP HFLASATTNH HSYLESASSL SLHNFGAGSV PSSREPRGLD WMLNGDPISL  180
GTSDSEWNTL MNNNKVGFNA MSSCSNTEPQ YMNSFPVYSP GLDQQHNKRS PTFLNPVLVP  240
METLQSDKPR VFIDAWSNAA TDQETNDADN KNSVSSIGKL SLSSLDLSMG GGYMHEEVGL  300
GLMEEPEPEE NNTSNGTKSG FSNWPTPPPW VASTTTPGGP LAEVLMPSTV TSTNDGAAAT  360
SNSNLSSPAT TMVSSPSGVL HKTLASLSDS SSNSSPRVPS SGANSEIALL RFNQK
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.489C1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016181626.10.0growth-regulating factor 1
RefseqXP_025682105.10.0growth-regulating factor 1
SwissprotQ9FJB83e-38GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A444X4490.0A0A444X449_ARAHY; Uncharacterized protein
STRINGGLYMA04G40880.21e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.15e-34growth-regulating factor 7
Publications ? help Back to Top
  1. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]