PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.2W5R5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 592aa    MW: 66973.8 Da    PI: 5.4221
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.2W5R5genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52231491127
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp GfrF+P+deelv++yL++k++g+  e+  vi+e+d++k+ePwdLp  + +++++ ew+fF+++d+ky++g+r nrat++gyWkatgkd++++s +
  Araip.2W5R5  23 LPLGFRFRPSDEELVDYYLRQKINGNGEEV-WVIREIDVCKWEPWDLPdlSVIRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-G 118
                  699************************888.89**************96447777888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyr 127
                  ++l+g+kktLvfy+grapkg++t+Wvmheyr
  Araip.2W5R5 119 STLIGMKKTLVFYTGRAPKGKRTNWVMHEYR 149
                  9*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6118173IPR003441NAC domain
PROSITE profilePS5100556.54223173IPR003441NAC domain
PfamPF023659.9E-2824149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MGAVVDCYPP HAGEVAVLSL NSLPLGFRFR PSDEELVDYY LRQKINGNGE EVWVIREIDV  60
CKWEPWDLPD LSVIRNKDPE WFFFCPQDRK YPNGHRLNRA TNHGYWKATG KDRKIKSGST  120
LIGMKKTLVF YTGRAPKGKR TNWVMHEYRP TLKELDGTNP GQNAYVLCRL FKKQDESLEV  180
SNCDEVEQTD SAPMAANYSP EEIQSDQALA EVSPSQVTDE KHQGVIPENS EEAVSNVITS  240
ADCHSDGYDA CERRNQAFEL PAEDIPPLNW DIFNDPEDKI FDDKLFSPVH SHIPPEFYYQ  300
ANNETNIADI LNSVNWDEIS YEDPYSQAQN NFFNNVKQSV SGSEPDAGLT NMTCVHPTNV  360
VYPEEAIHRK VALATTPQFC STFTSDFSAD EQKSSVALIQ NNSQMASFPD ARTVQVYNVF  420
NDYEQPRNLN TYVSGDTGIK IRTRQVRNEQ PAMIFTDQGN AARRIRLLKQ CADVSNKMAD  480
DGSPKQEHDS KPIIAGNKNK TFKSHTADKH DTANDLNERQ EKTESTDKRN MISKLAKGGS  540
SMLGLKGLLR RRLSYISKAS SNFKMWSCVV VASAFVLVSF VFFANIWGYI NL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-45111773169NO APICAL MERISTEM PROTEIN
1ut4_B7e-45111773169NO APICAL MERISTEM PROTEIN
1ut7_A7e-45111773169NO APICAL MERISTEM PROTEIN
1ut7_B7e-45111773169NO APICAL MERISTEM PROTEIN
3swm_A1e-441417711172NAC domain-containing protein 19
3swm_B1e-441417711172NAC domain-containing protein 19
3swm_C1e-441417711172NAC domain-containing protein 19
3swm_D1e-441417711172NAC domain-containing protein 19
3swp_A1e-441417711172NAC domain-containing protein 19
3swp_B1e-441417711172NAC domain-containing protein 19
3swp_C1e-441417711172NAC domain-containing protein 19
3swp_D1e-441417711172NAC domain-containing protein 19
4dul_A7e-45111773169NAC domain-containing protein 19
4dul_B7e-45111773169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.2W5R5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016180480.10.0protein NTM1-like 9
RefseqXP_025683950.10.0protein NTM1-like 9
TrEMBLA0A444X4G60.0A0A444X4G6_ARAHY; Uncharacterized protein
STRINGGLYMA04G40450.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.12e-96NAC transcription factor-like 9