PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.2BL8E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 320aa    MW: 36170.4 Da    PI: 9.0753
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.2BL8EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM28.54.2e-091947230
          NAM  2 ppGfrFhPtdeelvveyLkkkvegkklel 30
                  pGfrF Ptdeel+++yL+kk++g++ + 
  Araip.2BL8E 19 FPGFRFCPTDEELISYYLRKKLDGDEDRK 47
                 69*********************998554 PP

2NAM91.81.2e-285112553128
          NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++ew+fFs+r +ky++g++++rat+ gyWkatgk++ v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Araip.2BL8E  51 QSDNEWFFFSPRGRKYPNGSQSKRATECGYWKATGKERVVKS-GQNVIGTKRTLVFHLGRAPKGERTEWIMHEYCV 125
                  4689*********************************99999.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.0821141IPR003441NAC domain
SuperFamilySSF1019412.09E-4510140IPR003441NAC domain
PfamPF023654.0E-2620124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVDRDSSEAH MSIAASSIFP GFRFCPTDEE LISYYLRKKL DGDEDRKSFI QSDNEWFFFS  60
PRGRKYPNGS QSKRATECGY WKATGKERVV KSGQNVIGTK RTLVFHLGRA PKGERTEWIM  120
HEYCVNDKSQ DSLVICRLKR NTEFRASDHS NRTSHDSDCG VSEGVTVQGD TYVPIQDKET  180
GCSSKRTSSS NSSPSTTGQI ESSHRVNEEE DCYAEILNDD IIKLDESTLS RPSPPQGTAN  240
RRIRLRVPKS TVPKSRVPKS RVPTGNGCQC SKQSSNKINT FLSYPLVVFT FFVFTLLALG  300
FFFIRRSQTT AQYSQDLSRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-3391402164NO APICAL MERISTEM PROTEIN
1ut4_B7e-3391402164NO APICAL MERISTEM PROTEIN
1ut7_A7e-3391402164NO APICAL MERISTEM PROTEIN
1ut7_B7e-3391402164NO APICAL MERISTEM PROTEIN
4dul_A7e-3391402164NAC domain-containing protein 19
4dul_B7e-3391402164NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.2BL8E
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015936095.10.0NAC domain-containing protein 40 isoform X3
SwissprotQ9XIN72e-81NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A444Y7831e-134A0A444Y783_ARAHY; Uncharacterized protein
STRINGGLYMA13G39090.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.17e-82NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]