PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.17KGH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 722aa    MW: 78811.4 Da    PI: 5.9066
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.17KGHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      Araip.17KGH 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.2261973IPR017930Myb domain
TIGRFAMsTIGR015579.2E-162271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-82364IPR009057Homeodomain-like
PfamPF002491.7E-132467IPR001005SANT/Myb domain
CDDcd001671.38E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MDAYSSGEEV VIKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAQAKG VPIGQALDIE IPPPRPKRKP SNPYPRKTSA GVASLHSGAK  120
DGKLSSLESS HAKQALDLEK EPVPEKHNGD KVSHVKENKD ENCSKVFTLL QELPCSSVSS  180
ANKSSISWSV PLQNSCGLRE IIPSVKEVIA KDGTNKSFVT IELENRKLEI DDGKQTNGNS  240
SLENSDTVKL VQNEKTDGLN CELTIDGIQG NQNYPRHVTV HVVDGKLRTS TANPSQDMVF  300
QDSMFQPLGG INGQPNLFTN STVSNTSESQ NNTERSSVHQ SFLPYPPFIQ NNQGDYQSFL  360
QMSSTFSSLV VSTLLQNPAA HAAASFAATF WPCANSEASA DSPTCSQGGF PPRQNGSPPS  420
VAAIAAATVA AATAWWAAHG LLPMCAPLHT AFACPPTSMP ADQTLDPVCS EAQQAQQSPS  480
KSPVDISSDS EESGDAKLHA SPSKATDQEL NKEISEHIDS NKAKGRKPVD RSSCGSNTTS  540
SSELETDALE KDEQGKEEPE TADANNLAID SSNRRSRSVS NLTDSWKEVS EEGRLAFRAL  600
FAREVLPQSF SPPPDLLNKD QEMDSIKDNK QTTDIKDEGQ DSKKCSSIFE GIQKMMPCIE  660
NNEEEGLLTI GLGQGKLKTR RTGFKPYKRC SMEAKENRVG STGNQGEEQG SKRIRLEGEA  720
ST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.17KGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182525.10.0protein LHY isoform X1
RefseqXP_016182545.10.0protein LHY isoform X1
RefseqXP_016182548.10.0protein LHY isoform X1
RefseqXP_016182549.10.0protein LHY isoform X1
RefseqXP_016182550.10.0protein LHY isoform X1
RefseqXP_016182551.10.0protein LHY isoform X1
RefseqXP_016182552.10.0protein LHY isoform X1
RefseqXP_016182554.10.0protein LHY isoform X1
RefseqXP_016182560.10.0protein LHY isoform X1
RefseqXP_020970964.10.0protein LHY isoform X1
RefseqXP_025631854.10.0protein LHY isoform X1
RefseqXP_025631855.10.0protein LHY isoform X1
RefseqXP_025631856.10.0protein LHY isoform X1
RefseqXP_025631857.10.0protein LHY isoform X1
RefseqXP_025631858.10.0protein LHY isoform X1
RefseqXP_025631859.10.0protein LHY isoform X1
RefseqXP_025631860.10.0protein LHY isoform X1
RefseqXP_025631862.10.0protein LHY isoform X1
RefseqXP_025631863.10.0protein LHY isoform X1
RefseqXP_025631864.10.0protein LHY isoform X1
TrEMBLA0A445ACY90.0A0A445ACY9_ARAHY; Uncharacterized protein
STRINGGLYMA07G05410.60.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.12e-79circadian clock associated 1