PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.0550R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 330aa    MW: 37532.6 Da    PI: 9.2274
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.0550RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.5e-55251501128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL +kv ++++++ ++i+evd++++ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
  Araip.0550R  25 LPPGFRFHPTDEELISHYLYNKVIDTNFSA-RAIAEVDLNRSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKS 120
                  79**************************99.89***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfykgrapkgek+dWvmhe+rl
  Araip.0550R 121 LVGMKKTLVFYKGRAPKGEKSDWVMHEFRL 150
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6420175IPR003441NAC domain
PROSITE profilePS5100559.24325175IPR003441NAC domain
PfamPF023651.6E-2826150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
RVTLFILGVL TYQMENICSE VEMDLPPGFR FHPTDEELIS HYLYNKVIDT NFSARAIAEV  60
DLNRSEPWDL PWKAKMGEKE WYFFCVRDRK YPTGLRTNRA TEAGYWKATG KDKEIYRGKS  120
LVGMKKTLVF YKGRAPKGEK SDWVMHEFRL HGKFNPHNLP KSAKNEWVIC RVFQKSSAAK  180
KIHLTGIMRL DSSVFLPPLA DSSSSPSNTA TTAPYVPCFS NPIIHNQVGI FDPFSNTPFG  240
ADSFYTSQGM PMQHAQPPSC YTTQDHSILR TLLQNNSSNL RSGFKPAERE MAHHQTSLVD  300
ANNNNNNNGI TSVVAPQDLS SLWNYQVQIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-562118113171NO APICAL MERISTEM PROTEIN
1ut4_B9e-562118113171NO APICAL MERISTEM PROTEIN
1ut7_A9e-562118113171NO APICAL MERISTEM PROTEIN
1ut7_B9e-562118113171NO APICAL MERISTEM PROTEIN
3swm_A9e-562118116174NAC domain-containing protein 19
3swm_B9e-562118116174NAC domain-containing protein 19
3swm_C9e-562118116174NAC domain-containing protein 19
3swm_D9e-562118116174NAC domain-containing protein 19
3swp_A9e-562118116174NAC domain-containing protein 19
3swp_B9e-562118116174NAC domain-containing protein 19
3swp_C9e-562118116174NAC domain-containing protein 19
3swp_D9e-562118116174NAC domain-containing protein 19
4dul_A9e-562118113171NAC domain-containing protein 19
4dul_B9e-562118113171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.0550R
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187779.10.0NAC domain-containing protein 100
RefseqXP_025641313.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-122NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A445AB250.0A0A445AB25_ARAHY; Uncharacterized protein
STRINGGLYMA05G00930.21e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-118NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]