PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_969_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 609aa    MW: 68238.4 Da    PI: 8.3098
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_969_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.53.5e-34369423155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr+rWtpeLHe+Fveav++LGGse+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  Neem_969_f_2 369 KPRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMNVEGLTIYHVKSHLQKYRT 423
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.889366426IPR017930Myb domain
SuperFamilySSF466891.97E-18367424IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-31368426IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-25369423IPR006447Myb domain, plants
PfamPF002491.8E-10371422IPR001005SANT/Myb domain
PfamPF143792.4E-22454500IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MESSEKLATQ SQVALPTKYG RKQPKQHWAP LAHYSSHSSS PTSSFKPLTF LLKSPPLKFH  60
HQRILVIRLR PNGCDQGQMK PNTYSCKRGC DIVVEIKKTR TFKVLLSVNQ ELLCVRFGSS  120
TSGVYPIQSN HLLLRIQSRF ERASLERHSC EFKKKFLGKG SATMSSSFPV LPPSLDEKYS  180
KLPTSNPIAP QTSASSSRFP SNMHASSVST HQRYSQNSPF ISQSSRDGAR LPSSHFSPSE  240
VHHTPLINHP EENKDISWGI DPLQDFLDFP ENDPVQTGLM ENTGDIACHE WADQLISVDD  300
GPDLNWSEVL ADVNARDARS KTMYRMLKLS ADVQMQHPQV QSQVHQHQAV SNEEPHAVGN  360
PLSTVPPTKP RMRWTPELHE AFVEAVNKLG GSERATPKGV LKLMNVEGLT IYHVKSHLQK  420
YRTARHRPES SEGSSEKKSN LTEDMKSLDL KTTMSITEAL RLQMEVQKRL HEQLEIQRNL  480
QLQIEEQGRY LQKMFEQQRQ MENDKSKASS SSLGDPSAPL SESKQHASAN EISATPEANL  540
AKTGTDSCHA NSVLEESSRG LNQKQKAPET KTAEELDQDD DESSQKPTKR ARSNDTEDIS  600
PKSASNNTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-29369427260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024952051.10.0protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN52e-93PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLV4S0U90.0V4S0U9_9ROSI; Uncharacterized protein
STRINGXP_006470918.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.24e-89G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]