PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9433_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 353aa    MW: 38674.8 Da    PI: 9.4558
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9433_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.92.7e-131153345
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   i ++s r+ ++ kRr g+lKK +EL +LC++++ +ii+s+++k
  Neem_9433_f_1 11 IVSDSARKASLKKRRVGLLKKVSELTTLCGVNAFIIIYSPEDK 53
                   568899*********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.264153IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-18160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-21295IPR002100Transcription factor, MADS-box
CDDcd002666.58E-28285No hitNo description
PRINTSPR004046.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-131153IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MTRKKVKLVW IVSDSARKAS LKKRRVGLLK KVSELTTLCG VNAFIIIYSP EDKEPAMWPS  60
RPVVQQLLAR FHSLPEMERC KKMMNQETYL KERVTKVQEQ LKKHHRKNKE TDVSIIMRQI  120
YHDKTLDDCN VSELRGLIWF VEEKKKDIRK RIEYYQQVNP LPPETSLPPP NQLPAPVDAT  180
AQVGGSTSGD VRTATEPAHW DQWFIDMMNN SVNTAGSSSS RAKNDVGLTP HQAFAASCSA  240
ANQMGFPHGT LGAYNISGSD MGLPHGNIHI SSSSHGGGSD IGVGLPDINV GGNNNNRGNE  300
INLGLPQGNA AAGSTVASSN MGPSSEFFGG SIAGSDVGLP YHVTKPWPNN FYP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLVWIVSDSARKASLKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481616.11e-141agamous-like MADS-box protein AGL8 homolog
TrEMBLV4SW841e-127V4SW84_9ROSI; Uncharacterized protein
STRINGXP_006481616.11e-140(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.16e-30AGAMOUS-like 80