PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9363_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family B3
Protein Properties Length: 428aa    MW: 49275.3 Da    PI: 9.502
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9363_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.42.3e-17131051100
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    ffkv ++s    +++l++p kf++++g +       tl  ++g  Wev l  +k ++++++ +GW +Fv+ + +++g f+vF++ ++s+f  +v +
  Neem_9363_f_1  13 FFKVILQSTIE-NKMLRIPEKFVRRFGDE--LFSVATLVVPEGGAWEVGL--KKDGRKIWFHDGWIDFVEFHSICAGHFLVFEYRENSSF--HVLI 101
                    77777665555.557***********755..44589999***********..999999**************************988999..**** PP

                    E-SS CS
             B3  97 frks 100
                    f+ks
  Neem_9363_f_1 102 FDKS 105
                    *985 PP

2B352.11.2e-16335425699
                    ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
             B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                    ++s  + s+ +++p kfa+++  + ++ k ++++d++g++W v+l   + s+++ l++GW+ F k  +L  gD++vF+l+ ++   l+++v+r+
  Neem_9363_f_1 335 VRSKKTYSHYMYVPAKFADKYLRSDTTAKFIKIQDSDGKEWPVRL---RWSQWCGLKGGWRAFRKGMNLGGGDVCVFELIMKKVIVLKFSVLRA 425
                    5677788899***********445567789***************...6677889***********************9977777777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.2E-257107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-249107IPR015300DNA-binding pseudobarrel domain
CDDcd100172.66E-2111103No hitNo description
PROSITE profilePS5086313.71912105IPR003340B3 DNA binding domain
PfamPF023622.5E-1413104IPR003340B3 DNA binding domain
SMARTSM010197.6E-2113105IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-18324414IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-20324425IPR015300DNA-binding pseudobarrel domain
CDDcd100173.45E-14329424No hitNo description
PROSITE profilePS5086312.675330426IPR003340B3 DNA binding domain
SMARTSM010197.0E-12331426IPR003340B3 DNA binding domain
PfamPF023624.5E-15335424IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGAGSRRAEP PHFFKVILQS TIENKMLRIP EKFVRRFGDE LFSVATLVVP EGGAWEVGLK  60
KDGRKIWFHD GWIDFVEFHS ICAGHFLVFE YRENSSFHVL IFDKSACEIE YPSIWKEPKN  120
EEQNSVHGNE MEREDSDECP SNRPSSKMNT PQLQKIQVKP SFGSALGTKR RQKCAMSLES  180
SKLKYGYMTR NRKSKMEETA EMDESRQGKL QGNEMCNSQG SLHHKRHLLR NAENLYASSS  240
LARKMDSKID GTKFKTARYN GGYERKESYE VEKHSSDDDD VKKTKLDELE LLAWLEDMEI  300
FVSGALSYLS VETKQTVIDA VRLFKPKNPS FIAIVRSKKT YSHYMYVPAK FADKYLRSDT  360
TAKFIKIQDS DGKEWPVRLR WSQWCGLKGG WRAFRKGMNL GGGDVCVFEL IMKKVIVLKF  420
SVLRASAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1630942627143B3 domain-containing transcription factor VRN1
4i1k_B1e-1630942627143B3 domain-containing transcription factor VRN1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1853637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.12e-34B3 family protein