PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8966_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family bZIP
Protein Properties Length: 330aa    MW: 36249.4 Da    PI: 6.3575
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8966_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-09130178553
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                    kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  +l   +
  Neem_8966_f_1 130 KRAKRILANRQSAARSKERKARYMLELERKVQTLQTEATTLSAQLTLFQ 178
                    9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-16126190IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565128191IPR004827Basic-leucine zipper domain
PfamPF001703.4E-8130176IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-7130184No hitNo description
SuperFamilySSF579592.53E-10130181No hitNo description
CDDcd147033.17E-21131180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEIQDPQPQS KPKLESYPNP SLSSTNVAAS PSSLSSAFIR NESHHRRAHS EMNFRLRDDM  60
TTGTMMTTDP MGGGSSTTSL EEIGSEDDLF STYIDVDKHS NSVDGYGEVL EAKKAMPPDK  120
LAELWMVDPK RAKRILANRQ SAARSKERKA RYMLELERKV QTLQTEATTL SAQLTLFQRD  180
TTGLSAENTE LKLRLQAMEQ QAQLRDALNE ALKKEVERLK IATGEIVNPS ESFNMGIHPM  240
PYNHSNVFAV LQQPAGAPTG HQNMQLSALS HSQSSTAAHH LQQTSSQPAS DVSKNDEVGR  300
LQGLDISSKV SSFVKSEGPS LSASESSTTF
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017429100.11e-146PREDICTED: transcription factor RF2b-like
RefseqXP_022731010.11e-146transcription factor RF2b-like
SwissprotO228731e-90BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A0L9UWB31e-144A0A0L9UWB3_PHAAN; Uncharacterized protein
STRINGXP_007142045.11e-143(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.16e-86bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]