PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_867_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 281aa    MW: 32835.8 Da    PI: 4.3046
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_867_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.6e-223684149
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  k+ie +s r+v fskRr+g++KKAeEL+ LCdae+ +i+fs++g++y +
  Neem_867_f_4 36 KKIEKNSSRKVAFSKRRKGMFKKAEELCWLCDAEIGIIVFSPKGRVYCF 84
                  689*******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.5532888IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-292887IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-2629108IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-193050IPR002100Transcription factor, MADS-box
PfamPF003192.8E-223784IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-195065IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-196586IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEKPFRSLPT SWNDMEQQQQ AKKKPKGTGR KKIEIKKIEK NSSRKVAFSK RRKGMFKKAE  60
ELCWLCDAEI GIIVFSPKGR VYCFGYPSLN YVIDKFLNEN YDELKDYSDD SDSNDCVTEE  120
EEDDGEEEEG FWWEESIEDL NMEQLQIYKT YLEQLRCNVA TKIEEMVMRR TRERDFFGVM  180
VTEISIVSVQ SMEAVTSPRD HGEVGAYPYS WFRCSPSAIL FLTVLSTVFI SGDEDNNPWK  240
EAKEESMGPE AEEEKDDSLA TGEEGFWWKV PVECLSMEEY W
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468188.14e-63agamous-like MADS-box protein AGL28
TrEMBLA0A2H5N5J12e-61A0A2H5N5J1_CITUN; Uncharacterized protein
TrEMBLV4TR252e-61V4TR25_9ROSI; Uncharacterized protein
STRINGXP_006468188.11e-62(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-20AGAMOUS-like 61