PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8269_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 444aa    MW: 50662 Da    PI: 8.1788
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8269_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-29103154253
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                    prlrWtp+LH +Fv+ave+LGG+ekAtPk +l+lm+v gL+++hvkSHLQ Y
  Neem_8269_f_2 103 PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQIY 154
                    8*************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-2699155IPR009057Homeodomain-like
SuperFamilySSF466896.27E-13102155IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-20103154IPR006447Myb domain, plants
PfamPF002492.2E-7104152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MGNDVEEPGT AMTEDLEIQK SERSEEQAEN TSVASSQKCS VSFDLNEEAS SEKDDSLAKV  60
NVELSVEDDE KGTEGSSSNN NVSGEGGNER RSKVRQYVRS KLPRLRWTPD LHLSFVHAVE  120
RLGGQEKATP KLVLQLMNVR GLSIAHVKSH LQIYTCSDFP THFTCPMCLP HQMYRSKKLD  180
ETGQVLSHKY RSIQGRDHIR GIYQPVTSPR QHFRMENGGI VLAKNLLHEN NITRNIFQTP  240
QLSQRPFDFK PKFSRKSDHD VETIRPSSLI GKDHGDNIFL KSNAFHSLGK SPSSNHQIHA  300
IETAIGIGPM RPRRFLEEKR WPPLEMINSR RWKVNASNIL ANENTRSQPQ AHQISTMPMS  360
YCTMSRNDSM FRQFPFNSND SAGKFSSFQP NFEPPFLLEL NQDKMMKEKE WLPDLQLRLS  420
QRVGIDEEKS HCNIQEISTK LSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16104159358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16104159358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16104159358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16104159358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-16104159459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449512.21e-163uncharacterized protein LOC18051238
TrEMBLA0A2H5N5591e-161A0A2H5N559_CITUN; Uncharacterized protein
STRINGXP_006467640.11e-161(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-33G2-like family protein