PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8110_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 470aa    MW: 51630 Da    PI: 7.5822
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8110_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.89.1e-32281334255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt+ LH+rFv+ave LGG+e+AtPk++le+m+vk+Ltl+hvkSHLQ+YR+
  Neem_8110_f_1 281 PRMRWTSSLHARFVHAVELLGGHERATPKSVLEFMDVKDLTLAHVKSHLQMYRT 334
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-15278335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28279335IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23281334IPR006447Myb domain, plants
PfamPF002491.1E-6282333IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSCERVFSSS TESSLNPIPD LSLQIRPPNS APSSICTSAA GNEGDYSTLN IWRKDDDNNF  60
DDLKSHSDSS VIACKEAAAD TQLYLANPKN TPAAALEAES PWRRSFGTVC NKQDQTRLRN  120
HHHHQLLHQC GNTSQISNLN HGISLLDVSG LKPIKGIPVY NNSRFPFPNN HGEITVLDPK  180
FRFYQTTTTY PSSSPCTSYC SPSSTASVLG SSDHHHCGSS SGGAYRIGTA PRFNGISAET  240
ITPQLQYSHY GMGLGSSELF DGKIRSRYMP KMPNKRNMRA PRMRWTSSLH ARFVHAVELL  300
GGHERATPKS VLEFMDVKDL TLAHVKSHLQ MYRTVKSTSK PVSSPDGSGN EDMLPGTAAS  360
LHENANCLFN QRGSAISNES LQEHANCDLP SANLWSNSSS RGAWIQNGST CNQLDQHGAE  420
ILTSQQNYEN QCEGSTSNDG QSSTRYKNIR SNPSLEFCLG RPGWRSKEDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021292369.11e-143transcription repressor KAN1-like isoform X1
TrEMBLA0A061G3871e-142A0A061G387_THECC; Homeodomain-like superfamily protein, putative isoform 1
STRINGEOY214941e-143(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-61G2-like family protein