PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7_f_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 475aa    MW: 52231.3 Da    PI: 8.9967
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7_f_8genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.43.9e-25125181259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H h+
  Neem_7_f_8 125 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSDCCAKK-IECSDHSGNVIEIVNKGMHSHD 181
                 8********************************98.*********************7 PP

2WRKY32.51.7e-10296314321
                 -SS-EEEEEEE--TT-SS- CS
        WRKY   3 DgynWrKYGqKevkgsefp 21 
                 Dgy+WrKYGqK+vkg+++p
  Neem_7_f_8 296 DGYRWRKYGQKMVKGNPNP 314
                 9*****************9 PP

3WRKY46.95.5e-153573942259
                 EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Neem_7_f_8 357 ENYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD 394
                 68***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-19119183IPR003657WRKY domain
SuperFamilySSF1182901.44E-19121183IPR003657WRKY domain
SMARTSM007742.4E-23124182IPR003657WRKY domain
PROSITE profilePS5081117.006125183IPR003657WRKY domain
PfamPF031061.8E-16126180IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.4E-28279314IPR003657WRKY domain
PROSITE profilePS5081124.765289396IPR003657WRKY domain
SuperFamilySSF1182901.24E-8290338IPR003657WRKY domain
SMARTSM007746.6E-26294395IPR003657WRKY domain
PfamPF031068.0E-7296322IPR003657WRKY domain
SuperFamilySSF1182902.35E-12355396IPR003657WRKY domain
PfamPF031061.8E-9355393IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.4E-28357396IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MMTALRDSYI DAFPGLPEHD DRIKGFLHWE KVIASHQEVS VSIAAQDAES QAQNKLQSSM  60
CPTSLSELSP TSVTQPISSV PSPTLPGQKL SPIKVNNAAV VEAERQNSSE LKDVSVVHIV  120
KTPVSDGYNW RKYGQKQVKS PKGSRSYYKC TYSDCCAKKI ECSDHSGNVI EIVNKGMHSH  180
DPPRKNYCVR ESRLASSVGP ILGNNVTEQS IRMHNDSDPS TSSKDSIQDA NVVLERKRPN  240
LSENGNVAVK EEHVIEPEPK RRVKKSNIAC TDPLSKPGKK PKFVVHAAGD VGISGDGYRW  300
RKYGQKMVKG NPNPSLSLCC LRFQMTALRR LSWISDAPRC LGIEVTWSLW PFRTFDENYY  360
RCTSAGCPVR KHIETAVDNT SAVIITYKGV HDHDMPVPKK RHGPPSAPLV AAAAPASMNN  420
LQFKKTDAAQ SQMTSTQWSV GKEGELTGAA MDLGGEKAME SARTLLSIGF EIKPC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2360331e-174JX236033.1 Citrus trifoliata WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453624.10.0hypothetical protein CICLE_v10008135mg
RefseqXP_015384576.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-135WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4WJB70.0V4WJB7_9R
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-127WRKY DNA-binding protein 32