PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7694_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 321aa    MW: 35436.6 Da    PI: 7.7468
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7694_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.1e-32132185255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Neem_7694_f_3 132 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 185
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.77E-15129186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28130186IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23132185IPR006447Myb domain, plants
PfamPF002492.0E-7133184IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MRTAFSSPMP DLSLQISPPS VSDCEAREVR FDGLLRNNAL HSDGSSTTDS GSSGSDLSHE  60
NGFYNPERSY NLGPREPTLS LGFEMADLCP APPLQLPRAL NHHQQYQPQI NGREFKRNTR  120
MINGVKRSVR APRMRWTTTL HAHFVHAVQL LGGHERATPK SVLELMNVKD LTLAHVKSHL  180
QMYRTVKSTD KGSGQGQIDM GLNQRTGVVD LEGGLSCGRA DTGPSLNPPP TSAHKRQRGS  240
LPWVETNDRI KISHLKANDT RADGSKTALH LSDNDAVQEL DSSSLSPSDD KLLNLEFTLG  300
RPSWQMDYAE SSNHELTILK C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-17133187357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-17133187357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-17133187357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-17133187357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006473404.11e-179probable transcription factor KAN4
TrEMBLA0A2H5NGW71e-178A0A2H5NGW7_CITUN; Uncharacterized protein
TrEMBLV4V7S21e-178V4V7S2_9ROSI; Uncharacterized protein
STRINGXP_006473404.11e-179(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.17e-66G2-like family protein