PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7583_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 294aa    MW: 32379 Da    PI: 6.7837
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7583_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.3e-34173230259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  Neem_7583_f_1 173 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSFQDPSIVITTYEGQHNHP 230
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-35157232IPR003657WRKY domain
SuperFamilySSF1182904.58E-30164232IPR003657WRKY domain
PROSITE profilePS5081132.765167232IPR003657WRKY domain
SMARTSM007744.1E-40172231IPR003657WRKY domain
PfamPF031069.3E-27173230IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSNEPGNLYF RSLFQDDQHG DITGTSMPVS IAGSSPDYNP QQFDPSQMSY TDCLHGFMDY  60
NSLEKAFGMS PSSSEVFSSI EGHQKQIIGP GELCGGSENN VGTTPNSSIS SSSTEAGAEE  120
DSGKSKKDLQ PKGSEDGGDS SKKISKAKNK KGEKRQKEPR FAFMTKSEVD HLEDGYRWRK  180
YGQKAVKNSP YPRSYYRCTT QKCTVKKRVE RSFQDPSIVI TTYEGQHNHP IPTTLRGNAA  240
GMFQPSSMLT PTMPMNLSSF PQEWLGLLAC TAVFLRGILV SKMGENDDEE GKNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-29162232777Probable WRKY transcription factor 4
2lex_A3e-29162232777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7089767e-39JF708976.1 Dimocarpus longan WRKY transcription factor 29-1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445471.11e-105PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ26e-70WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A0D2S1Y11e-104A0A0D2S1Y1_GOSRA; Uncharacterized protein
STRINGGorai.009G157300.11e-105(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.18e-60WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]