PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7370_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 650aa    MW: 71019.6 Da    PI: 8.4328
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7370_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461e-14159198242
            TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                    ++k+CnC++s+Clk+YCeCfaag +C+  C+C +C+N+ e+
  Neem_7370_f_3 159 KQKQCNCRNSRCLKLYCECFAAGIYCDG-CNCINCHNNVEH 198
                    89**************************.********9876 PP

2TCR50.54.1e-16260299140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Neem_7370_f_3 260 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 299
                    589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.4E-19158198IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.733159300IPR005172CRC domain
PfamPF036389.4E-12160195IPR005172CRC domain
SMARTSM011141.5E-19260301IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12263298IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MEQGETISDF APKKLARQLD FTMCRASANG TLPEQSVNSQ SQQSQTQSHS VLQAQPKSQQ  60
QVQSQAASQS QSQSQPLVPS QLLPPSQQQS SHPQVQSQMK SPLQAMPQRQ ARPQQMRMVQ  120
RVPHPVHKLP LPTLHAVKQE SPRSRPWGSI EAKDGTPKKQ KQCNCRNSRC LKLYCECFAA  180
GIYCDGCNCI NCHNNVEHEA ARQEAVGATL ERNPNAFRPK IASSPHGSQD ARKQSIFSPD  240
PCPHPSTQKE DAREAQLAAK HNKGCHCKKS GCLKKYCECF QANILCSENC KCLDCKNFEG  300
SEERRALFHG DHNAIAFMQK AANAAINGAV GSSGYGTPLA SNKRKSEELS FGVTAKDHLI  360
NRNAQSQQGN HLRNCAVPSS QSFPVSWTAN AAVLGSSKSA LRSPLADILQ PQDMKELCSF  420
LVIVSSEATK TLTEKAGKTD RQKSTTVASS IQDSEDGKKG NAVHNGVPDD RLSGNQMDVD  480
RTSGSGSDAG DLLNERPLSP GTRALMCDEE DTVFMSAGPP TGLANHCKNT NQKSNGYEST  540
RFYAEQERLI LTRFRDFLNR LITCGSIKET MCSPLVKSET RTQQKPVEDG TIRAGTEARR  600
YKELYDDACP RSAVPMTVES SQTVSTVTAT HNNDLPMKIG LPIGNGFDGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-311513092132Protein lin-54 homolog
5fd3_B6e-311513092132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476073.10.0protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD11e-144TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067GJ650.0A0A067GJ65_CITSI; Uncharacterized protein
STRINGXP_006476073.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-145Tesmin/TSO1-like CXC domain-containing protein