PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7295_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 792aa    MW: 89203.1 Da    PI: 6.3261
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7295_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3764.3e-24140241199
                    EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                    f+k+lt sd++++g +++ +++aee+      + k++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +++
  Neem_7295_f_1 140 FCKTLTASDTSTHGGFSVLRRHAEEClpaldmS-KQPPTQELVTKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSSKKLVAGDAFIFL--RGETG 232
                    99*****************************63.4444569************************************************..44999 PP

                    ..EEEEE-S CS
             B3  91 elvvkvfrk 99 
                    el+v+v+r+
  Neem_7295_f_1 233 ELRVGVRRA 241
                    9*****996 PP

2Auxin_resp120.11.7e-39266348183
     Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                    a+ha++t+++F+v+Y+Pr+s++eF+v+++k+++++k+ +++GmRfkm+fe+e+++e+r++Gtv+gv+d+dp++Wp+S+Wr+Lk
  Neem_7295_f_1 266 AWHAVATGTMFSVYYKPRTSPAEFMVPYDKYMESIKNDYTIGMRFKMRFEGEEAPEQRYWGTVIGVEDVDPMKWPGSRWRCLK 348
                    89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-38133269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-40133255IPR015300DNA-binding pseudobarrel domain
CDDcd100173.18E-20139240No hitNo description
PfamPF023624.8E-22140241IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899140242IPR003340B3 DNA binding domain
SMARTSM010191.7E-21140242IPR003340B3 DNA binding domain
PfamPF065071.2E-35266348IPR010525Auxin response factor
SuperFamilySSF542779.81E-13667746No hitNo description
PROSITE profilePS5174527.63669762IPR000270PB1 domain
PfamPF023093.4E-7715760IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MAAETSGEMF LGQSVCRSET TASMEKVDSS GDALYKELWH ACAGPLVTVP RQGDVVFYFP  60
QGHIEQVQAS MNQASDQQMP AYDLPDKILC RVVNVQLKAE PDTDEVFAQM TLLPLSKEDE  120
KSVEKKAAGP LPPRPRVYSF CKTLTASDTS THGGFSVLRR HAEECLPALD MSKQPPTQEL  180
VTKDLHGNEW RFRHIFRGQP RRHLLQSGWS LFVSSKKLVA GDAFIFLRGE TGELRVGVRR  240
AMRQPTTISS SVISSHSMHI GVLATAWHAV ATGTMFSVYY KPRTSPAEFM VPYDKYMESI  300
KNDYTIGMRF KMRFEGEEAP EQRYWGTVIG VEDVDPMKWP GSRWRCLKVR WDETSPHHRP  360
DKVSPWEIEH SVAPAVDALP VCRLKRPRPN MVASTISSIP PKEGSSKVTV DHSPDFESSR  420
VLRGVCSGNN DLDSVKSPAA RMPSQGPWSS DESCKFSRTF LEQNPDYADQ VKECDSHQES  480
MFKFFPQSMM HLRNPFNMVE SGMELHRAED KEMLCKNSVN NRFGTLRGYD RLHSLEFEKQ  540
PGKLLDLFSP SDAEKSSHPM AADEQILPEK QEELMKSKGE NGCKIFGISL MSNPVATEPT  600
MQHTCPLHES WEQINLASEH MQHPSSNILF EQLKSAETAI GGDEQGKPFQ PSDQLSRDAT  660
GKHLGGSSRS CVKVHKQDIA VGRSVDLSKF TGYDELIAEL DRMFEFNGEL ITPNKKWLIV  720
FTDDEGDMML VGDDPWLEFC SMVRRIYVYT REEIKQMAPR PLNPKLEENS VADKKNGPTD  780
DKCSSHPPVL SP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1653236917353Auxin response factor 1
4ldw_A1e-1653236917353Auxin response factor 1
4ldw_B1e-1653236917353Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1384388KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268849.10.0PREDICTED: auxin response factor 2
RefseqXP_010656858.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLF6HWQ30.0F6HWQ3_VITVI; Auxin response factor
STRINGVIT_01s0244g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  7. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  8. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  9. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  10. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  11. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  12. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  13. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  14. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]