PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7256_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 828aa    MW: 92383.6 Da    PI: 6.0598
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7256_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.51.5e-102172605499
                    EETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
             B3  54 kksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     +++r++lt+GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  Neem_7256_f_2 217 SQPRRHLLTTGWSVFVSSKKLAAGDAFIFL--RGENGELRVGVRRH 260
                    57899*************************..449999******96 PP

2Auxin_resp111.67.9e-37285367183
     Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                    a+ha++t++ F+++Y+Pr+s+seF+v+v+k+++a k+k++vGmRfkm fe+e+++err+sGt+vgv d +++ Wp+S+WrsLk
  Neem_7256_f_2 285 ASHAIATGTLFSIFYKPRTSQSEFIVSVSKYLEAKKHKLAVGMRFKMTFEGEEVPERRFSGTIVGVGDNKTLAWPDSEWRSLK 367
                    789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.85E-24118186IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-36126274IPR015300DNA-binding pseudobarrel domain
CDDcd100172.57E-14127259No hitNo description
PROSITE profilePS508639.404129261IPR003340B3 DNA binding domain
SMARTSM010192.0E-7129261IPR003340B3 DNA binding domain
PfamPF023629.5E-8217260IPR003340B3 DNA binding domain
SuperFamilySSF1019368.89E-12218288IPR015300DNA-binding pseudobarrel domain
PfamPF065071.4E-34285367IPR010525Auxin response factor
PfamPF023097.5E-7579622IPR033389AUX/IAA domain
PROSITE profilePS5174528.248586679IPR000270PB1 domain
SuperFamilySSF542777.19E-12588664No hitNo description
PfamPF023098.3E-7631676IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MAYAAAPLNH SSGGPRSGGA NDALYRELWH ACAGPLVSLP REGERVYYFP QGHMEQLEAS  60
MHQGLEQQMP SFNLPSKILC KVVHVQRRAE TETDEVYAQI TLLPEPDQSE VTSPDPPLPE  120
LEKCTVHSFC KTLTASDTST HGGFSVLRRH ADDCLPPLDM SQQPPWQELV AIDLHGNEWR  180
FRHIFRVVNL RQFFWSLGIF ESKLVLGLIL PVLLVASQPR RHLLTTGWSV FVSSKKLAAG  240
DAFIFLRGEN GELRVGVRRH MRQQTNMPSS VISSHSMHLG VLATASHAIA TGTLFSIFYK  300
PRTSQSEFIV SVSKYLEAKK HKLAVGMRFK MTFEGEEVPE RRFSGTIVGV GDNKTLAWPD  360
SEWRSLKVQW DEPSSILRPE RVSPWELEPL VANSTTSTAQ PAQRNKRARP PVLPSQAPDL  420
SVLGMWKSPV DSAAFPYCDS PHGRDLYPSP KLSTAAKGNP LGFSGTNSQP AVSSNSMYWS  480
NRVENLTESF APVVNKECGE RRPVSGNTYR LFGIQLVDNS NIEEASPAFT MSGTMGDDRP  540
IPSLDADSDQ HSEPSNINRS DVPSVSCDAE KSSLRSPQES QSRQIRSCTK VQMQGIAVGR  600
AVDLARFDCY EDLLKKLEEM FDIEGELCGS SKKWQVVYTD DEDDMMMVGD DPWHEFCSMV  660
RRIYIYTAEE VKRLSPKTKL PVNEEVKPAK PDVDTAINTE DRSSPTLPSA PPLPPWLEYQ  720
QTLDAVFAAE SVHPGPDLAH AVEPQFSLPE IVVDTASVNP AMLPVSDNSS ISYQQYMDPN  780
PVYGLPVVQT TRRERLSGFF GIVFKFGTSL FRCFCPCFHI REAYEKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.063962361Auxin response factor 1
4ldw_A0.063962361Auxin response factor 1
4ldw_B0.063962361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Acts as repressor of IAA2, IAA3 and IAA7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16176952}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4454133e-63JX445413.1 UNVERIFIED: Toona ciliata clone contig 60403 chloroplast sequence.
GenBankJX4454203e-63JX445420.1 UNVERIFIED: Toona ciliata clone contig 16 chloroplast sequence.
GenBankJX4454543e-63JX445454.1 UNVERIFIED: Toona ciliata clone contig 00004 chloroplast sequence.
GenBankJX4454643e-63JX445464.1 UNVERIFIED: Toona ciliata clone contig 119 chloroplast sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431443.10.0auxin response factor 1 isoform X1
RefseqXP_024039738.10.0auxin response factor 1 isoform X1
RefseqXP_024039739.10.0auxin response factor 1 isoform X1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLV4SAY20.0V4SAY2_9ROSI; Auxin response factor
STRINGXP_006431443.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Montesinos JC,Pastor-Cantizano N,Robinson DG,Marcote MJ,Aniento F
    Arabidopsis p24δ5 and p24δ9 facilitate Coat Protein I-dependent transport of the K/HDEL receptor ERD2 from the Golgi to the endoplasmic reticulum.
    Plant J., 2014. 80(6): p. 1014-30
    [PMID:25312353]
  2. Marais C, et al.
    The Qb-SNARE Memb11 interacts specifically with Arf1 in the Golgi apparatus of Arabidopsis thaliana.
    J. Exp. Bot., 2015. 66(21): p. 6665-78
    [PMID:26208648]
  3. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  4. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]