PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_7049_f_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 298aa    MW: 33322.9 Da    PI: 5.2446
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_7049_f_7genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.9e-32110166258
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                    dDgy+WrKYGqK++k+s++prsYY+Ct ++C++kk+vers +dp++++itYeg H h
  Neem_7049_f_7 110 DDGYKWRKYGQKSIKNSPNPRSYYKCTNPRCSAKKQVERSCDDPDTLIITYEGLHLH 166
                    8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.164104169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-29106166IPR003657WRKY domain
SuperFamilySSF1182901.83E-26107166IPR003657WRKY domain
SMARTSM007747.6E-35109168IPR003657WRKY domain
PfamPF031062.4E-25110166IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEKEKDSWFE DELVRELLDD ENPLFLLPKE TTEAKSSPSN EDQVVNRVTS AMYSGPTIED  60
IENALSVTTG KEQYSQAISQ ARISLLEGGF SKIEHKYTLK IKSCGNGMAD DGYKWRKYGQ  120
KSIKNSPNPR SYYKCTNPRC SAKKQVERSC DDPDTLIITY EGLHLHFAYP YFLLRQPQQA  180
SPPTKKRKSF LPQLEETKQQ TAGGQQNPSN FDNTEAPSGA FDDCSGLRDP AAEQLSSTQG  240
LLEDVVPLMI RNPSGNNNSV SSNNSSCSSY RSPPTSPSSL SWSPSYSLSR FDMGINYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-201081661371WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006480891.11e-121probable WRKY transcription factor 49
TrEMBLA0A2H5P6H61e-119A0A2H5P6H6_CITUN; Uncharacterized protein
STRINGXP_006480891.11e-120(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94052637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-60WRKY DNA-binding protein 49