PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6787_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 395aa    MW: 44009.1 Da    PI: 9.845
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6787_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.28.9e-3446100155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Neem_6787_f_1  46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-3144101IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2346101IPR006447Myb domain, plants
PfamPF002494.6E-104899IPR001005SANT/Myb domain
PfamPF143791.3E-23192238IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MYHHHQHQGK SIHSSSRMPM PTERHLFLQG GNGPGDSGLV LSTDAKPRLK WTPDLHERFI  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQKYRL SKNLHGQAHN GNNKIGKRTM  120
SQKLIYNSFK FARKIKIAMH FFSCKAHTGI RGLNFKSSGV GPVAVAAERM PEANGTHMNN  180
LSIGPQPNKS LHISETIQMQ IEVQRRLHEQ LEVQRHLQLR IEAQGKYLQA VLEKAQETLG  240
RQNLGTAGLE AAKVQLSELV SKVSTQCLNS TFSDLKDLQG GLYPQQPQAN QPTDCSMDSC  300
LTSCEGSQKD QEIHNGGIAL RPFHGTTTLE PKEIVEEAML QQTELKWGED LKESKFLSSI  360
GKERGPGELS IGVRPQGEKG QWQQQFSRGE IQNKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443380.10.0myb-related protein 2
RefseqXP_006479082.10.0myb-related protein 2
RefseqXP_006479083.10.0myb-related protein 2
RefseqXP_024044798.10.0myb-related protein 2
SwissprotQ9SQQ91e-146PHL9_ARATH; Myb-related protein 2
TrEMBLA0A067EVY10.0A0A067EVY1_CITSI; Uncharacterized protein
TrEMBLV4VTW00.0V4VTW0_9ROSI; Uncharacterized protein
STRINGXP_006443379.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-149G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]