PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6755_f_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 94aa    MW: 10748.7 Da    PI: 10.4808
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6755_f_6genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.8e-281059251
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly+++s
  Neem_6755_f_6 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFAS 59
                   8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.371161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-29267IPR002100Transcription factor, MADS-box
CDDcd002652.41E-38265No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFAST  60
RTKTIKQLAE LQCGKESLKV LEWYFNFIKE LCNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-18160160MEF2C
5f28_B2e-18160160MEF2C
5f28_C2e-18160160MEF2C
5f28_D2e-18160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021888089.17e-37MADS-box transcription factor 23-like isoform X2
SwissprotQ6Z6W24e-34MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A445H7I63e-36A0A445H7I6_GLYSO; Agamous-like MADS-box protein AGL16
STRINGevm.model.supercontig_177.143e-36(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.24e-36AGAMOUS-like 16
Publications ? help Back to Top
  1. Guo S, et al.
    The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14.
    Nat Commun, 2013. 4: p. 1566
    [PMID:23463009]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  4. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]