PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_672_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 191aa    MW: 21221.2 Da    PI: 10.3898
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_672_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.6e-311669155
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Neem_672_f_3 16 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 69
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0591372IPR017930Myb domain
SuperFamilySSF466891.25E-201373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-311574IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-241769IPR006447Myb domain, plants
PfamPF002495.3E-81968IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGSGAGSDEP ARTLKRPRLV WTPQLHKRFV DAVAHLGIKN AVPKTIMQLM SVDGLTRENV  60
ASHLQKYRLY LKRMQGFSPV PPHFLHPGRA NSDHYLPYVP VTALHPQQMA VAAAVGSPHL  120
QSHQYHRQMN HFGSPPNGQF EHHLFARQAQ PQQVHRMGAP VHSTVPSGYV EDLESANGGR  180
KVLTLFPTGD D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-331672157Transcription factor LUX
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482043.11e-118transcription factor MYBC1-like
TrEMBLA0A067ER431e-117A0A067ER43_CITSI; Uncharacterized protein
TrEMBLV4T2L91e-117V4T2L9_9ROSI; Uncharacterized protein
STRINGXP_006482043.11e-118(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-73G2-like family protein