PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6714_f_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 148aa    MW: 16418.9 Da    PI: 9.654
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6714_f_6genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.13.5e-161559145
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   k+ie +  r vtfskRr+g++KKA+E    ++ae+av++fs+ g+
  Neem_6714_f_6 15 KKIEKQNLRMVTFSKRRQGLFKKAQEYAQRTGAEIAVLVFSPAGN 59
                   689***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-21766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.32767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-21876IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-13929IPR002100Transcription factor, MADS-box
PfamPF003192.6E-181661IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-134465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGPPTGKGKR KIEIKKIEKQ NLRMVTFSKR RQGLFKKAQE YAQRTGAEIA VLVFSPAGNT  60
FVHGSPSFDA VVEKFLIGGN SGQKGVKNGE CETEARGFLV GLEEKMNGCR SVDELATVKA  120
ELEEVRQKVL QRLTRLEEDE FVSSLLNC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388040.16e-65agamous-like MADS-box protein AGL61
RefseqXP_015388538.11e-64agamous-like MADS-box protein AGL61
TrEMBLA0A2H5QI521e-62A0A2H5QI52_CITUN; Uncharacterized protein
STRINGXP_006442528.13e-62(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2014436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.14e-17AGAMOUS-like 29