PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6473_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 388aa    MW: 44579.5 Da    PI: 9.354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6473_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.85.1e-28226280155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k r+ W+ eLH+ Fv+++++LGG + AtPk+i++lm v+gLt++++kSHLQkYRl
  Neem_6473_f_4 226 KVRRSWSIELHRLFVDVLNHLGGCQAATPKQIRQLMRVDGLTNDEIKSHLQKYRL 280
                    679***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.787223283IPR017930Myb domain
SuperFamilySSF466891.04E-14224284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-25225284IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-22226280IPR006447Myb domain, plants
PfamPF002498.0E-6228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEVNLDLSLV HVPISKSELL RDVSKTKEVS QKVSKLNDYI MRLEEEKQKI GGFKRELPLI  60
MFLVKNAIGK LKKEVMQCTE AQEQPEVIAS KTNTKEGGEV EKINDLSDKR EWTSSFQLWS  120
SDINFDHKRQ DSVSEVQLRR QENNQSVHEN PIELFNCWYR DGAFVPFREQ IGSARSRDNE  180
VSQVPGLSLM MPGLKLDSRE PKKVGRRPKW YARSENNRRQ RRQCRKVRRS WSIELHRLFV  240
DVLNHLGGCQ AATPKQIRQL MRVDGLTNDE IKSHLQKYRL YLHRYENMAA GTEHRPWMPN  300
DQFGDNSSPG TLHCNSPQSP VLSRSGKEIS TTGGTSMGAK EDVRSDGHSW HGKVCIPTEV  360
DVQSQELPMN FAGTRTSFHG NQLINIDI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P6RN792e-86A0A2P6RN79_ROSCH; Putative transcription factor MYB-HB-like family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-50G2-like family protein