PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6357_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 301aa    MW: 34248.2 Da    PI: 5.1189
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6357_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.21.5e-39101101101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rr+C+++C+lapyfp +qpk f+n+hklFG+sn+lk+lk l+ e++++am+s++y+A++r + Pv+G+ g+i +l+ q+ q+++el++
  Neem_6357_f_2  10 ACAACKYQRRRCSAECPLAPYFPPDQPKMFQNAHKLFGVSNILKILKILDSEQKPEAMRSIIYQANIRDKYPVHGCWGIICQLRYQIWQAEEELHA 105
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  Neem_6357_f_2 106 VHAQL 110
                    *9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5019110IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CSAECPLAPY FPPDQPKMFQ NAHKLFGVSN ILKILKILDS  60
EQKPEAMRSI IYQANIRDKY PVHGCWGIIC QLRYQIWQAE EELHAVHAQL DIYRQHYQQQ  120
VQVSSMTDDV PSQLELGMAP PNGLSLFNHN PQPYSAVPAL PLSQHHSYSN NSYNSPYMDT  180
KDNVSNSMWF QHPYTTNNNN VNSIPMQSHL VASQPLAIQQ EVVQDYDEIH PFFDTIDDRQ  240
SYIDSKEAYE SSSLFSDFDV YESIFTCSSE ESLKDTTQSI EHVAENELKS AAACFSLTSV  300
N
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476673.11e-168PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS64e-66LBD27_ARATH; LOB domain-containing protein 27
TrEMBLV4TMK41e-167V4TMK4_9R
STRINGPOPTR_0012s07390.11e-125(Populus trichocarpa)
STRINGPOPTR_0015s07780.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.16e-64LOB domain-containing protein 27