PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5945_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 254aa    MW: 28814.5 Da    PI: 4.996
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5945_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.71.9e-205599246
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                   + +nks  qvtfskRr+g++ KA EL++LC+aev +i+fs++gk+
  Neem_5945_f_3 55 KLQNKSSLQVTFSKRRTGLFSKAMELCILCGAEVGIIVFSPNGKI 99
                   5689***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-3146105IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.54446106IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-2647122IPR002100Transcription factor, MADS-box
CDDcd002654.06E-3247119No hitNo description
PRINTSPR004042.0E-194868IPR002100Transcription factor, MADS-box
PfamPF003197.8E-2257100IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-196883IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-1983104IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MLPSITTEKE ELKPKPLSIT MSGSNTNNNG DSSSNNENQK TRKATRGRQK IEIKKLQNKS  60
SLQVTFSKRR TGLFSKAMEL CILCGAEVGI IVFSPNGKIF VVGHPDFDTV LNRYLDENHY  120
EQAAAVPCVQ QHNREYEEAL IELDMEKKKA KMIEEEKEKN KSGRAWWEES IDGMGIEELE  180
EYVKAMKKLR SEVQSRVNEM MMLNDYLMPN NINIMNQEDG FGNIVSSSNN EDISVNGGCI  240
ATDFDFGEHF LNNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-1447118172Myocyte-specific enhancer factor 2A
3kov_B2e-1447118172Myocyte-specific enhancer factor 2A
3kov_I2e-1447118172Myocyte-specific enhancer factor 2A
3kov_J2e-1447118172Myocyte-specific enhancer factor 2A
3p57_A2e-1447118172Myocyte-specific enhancer factor 2A
3p57_B2e-1447118172Myocyte-specific enhancer factor 2A
3p57_C2e-1447118172Myocyte-specific enhancer factor 2A
3p57_D2e-1447118172Myocyte-specific enhancer factor 2A
3p57_I2e-1447118172Myocyte-specific enhancer factor 2A
3p57_J2e-1447118172Myocyte-specific enhancer factor 2A
5f28_A2e-1447118273MEF2C
5f28_B2e-1447118273MEF2C
5f28_C2e-1447118273MEF2C
5f28_D2e-1447118273MEF2C
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422729.24e-95agamous-like MADS-box protein AGL23
TrEMBLV4U9K67e-94V4U9K6_9ROSI; Uncharacterized protein (Fragment)
STRINGXP_006422729.11e-94(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15814714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-33AGAMOUS-like 62